KEGG   Pseudothermotoga hypogea: AJ81_08360Help
Entry
AJ81_08360        CDS       T04277                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
phy  Pseudothermotoga hypogea
Pathway
phy00670  One carbon pool by folate
phy01100  Metabolic pathways
phy01120  Microbial metabolism in diverse environments
phy01200  Carbon metabolism
Module
phy_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:phy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AJ81_08360
Enzymes [BR:phy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AJ81_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA Nas2_N Phageshock_PspD
Motif
Other DBs
NCBI-ProteinID: AJC74189
UniProt: A0A0X1KSI7
Position
1683848..1685497
Genome map
AA seq 549 aa AA seqDB search
MMTGSNQVRLLPIEEVAKKLSIPRKHLKPYGDYIAKVSHKLLSELKPKGKLVIVTAITPT
PAGEGKTTTSIGLSMALNKLGYSSIVTLREPSLGPVFGIKGGATGGGKSQVLPMEDINLH
FTGDIHAVASAHNLISAMIDAHVRFGNELDIDVTKINWPRTMDMNDRALRQIVVALGGHA
NGYPRQDSFVITAASEIMAILCLAKDLHDLKKRVGDVVVAWTRTNKPVRVSDLQVQGSVA
VLLKDAINPNLVQTSENTPAFVHGGPFANIAHGTNSIIATKMALGLSDFVVTETGFGSDL
GAEKFLDFVAPVADVRPSAVVIVATVRALKYHGGMNLKELAKPNLEALKKGVENLKVHVE
NMRKYRVPVVVAINRFETDSDEELQLLKKCVEDMDVPVALNEAFAKGSEGAIELAEKVVR
VADDSRYEPLLKGSESVREKIQILAREIYRARGVVFTKEAETSLERLEKNGYGNLPVIVA
KTQYSISDDPDKLGAPKDYTFTVRDFLLSAGAGFVVAVSGDIMLMPGLGKKPNAVNIDID
GNGNIVGLF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacaggttctaaccaggttcggttgttgcccatcgaagaggtggctaagaaactc
tctattccgagaaagcatctcaagccctacggcgattacatagccaaagtctcgcacaaa
ttgctttcggagctgaagcccaaaggcaagctggtcatcgtcactgcgataactccgaca
cctgccggggagggtaaaacgaccacgagcataggcctgtcgatggcactcaacaaactc
ggttacagttcgatcgtgaccctcagagagccatccttgggtccggttttcggcataaag
gggggcgcgacgggtggtggcaagtctcaggttttaccgatggaggacatcaaccttcac
ttcaccggagacatacacgctgtggcgagtgcgcacaacttgatctccgccatgattgac
gcacacgtgagattcggcaacgagctcgacatagatgtgaccaagatcaactggcccaga
acgatggatatgaacgatcgtgcgttgagacagatcgttgtggctctgggtgggcatgcg
aacggttatcccaggcaggatagtttcgtgatcactgcggcgtccgaaattatggccata
ctctgtttggccaaagacttgcacgatttgaagaagcgcgttggcgatgtggttgttgct
tggacaaggacgaacaagccggtcagagtttcagacctccaggttcaaggttctgttgcg
gtcctcttgaaggatgccatcaacccgaacctggttcaaacgagcgagaacacccctgct
ttcgttcacggaggaccctttgccaacattgcacatgggacgaattccataatcgccacg
aagatggcgcttggcttgagcgatttcgtggtaacggagacgggctttggctcagatctc
ggtgctgagaaatttctggacttcgttgcgccggtagctgacgtcaggccttcggcagtc
gtaatcgtggcaactgtgagggcgttgaaatatcatggaggaatgaatttgaaggaactg
gccaaaccgaaccttgaggcgttgaagaagggtgtagagaatctcaaggttcacgtcgaa
aacatgagaaagtaccgtgtccccgttgtcgtcgcaatcaacaggttcgaaaccgattcc
gatgaggaacttcaactcctgaagaagtgtgttgaagacatggacgttcccgttgcgttg
aacgaagctttcgcaaagggttccgaaggtgcgatcgagttggcagagaaagtcgtccga
gtggcggacgattccaggtacgaacctctgttgaagggatcagaatctgtgcgcgaaaag
atccaaatactcgctcgagagatctatcgagccaggggggttgttttcaccaaggaagca
gaaacttccctcgaaaggctcgagaagaacggttacggcaacttgcccgtgatagtcgca
aagacgcagtactcgatctctgacgatcctgacaagctcggtgcacccaaagactacact
ttcaccgtgagggattttctcttgtccgctggcgcaggtttcgtggtcgctgtgtcggga
gacatcatgttgatgccagggcttggcaaaaagccgaacgcggtgaacatcgatatcgat
gggaacggtaacatcgttggactcttctga

DBGET integrated database retrieval system