KEGG   Pangasianodon hypophthalmus (striped catfish): 113524125Help
Entry
113524125         CDS       T05759                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00120  Primary bile acid biosynthesis
phyp01100  Metabolic pathways
phyp03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    113524125
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    113524125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:phyp00199]
    113524125
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     113524125
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     113524125
Cytochrome P450 [BR:phyp00199]
 Cytochrome P450, animal type
  CYP8 family
   113524125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 113524125
NCBI-ProteinID: XP_026766058
Position
Unknown
AA seq 512 aa AA seqDB search
MSFLLQILIALFLSLLGGLYVLGAFRRRRSGEPPLDKGPLPWLGHVLEFRRDTAKFLERM
RKKHGDIFTVQLGGFYFTFLTDPLSFGSVVKEARAKLDFNEFAKHLVQRVFGYDPLEDDH
KLIQASSNKHLMGDGLVMITQAMMNNLQNLMLHSIKSGNDDERLWQEDGLFAYCYNIVFR
AGYLALFGNEVAKTSGSVDKAKELDRKVSDELFYEFRKYDQLFPKLAYGVLGPSEKMEAE
RLKRLFWNVLSVKKVNTKENISGWVSESQQMRAERGMHESMQDRHMFLLLWASQGNTGPA
SFWLLLFLMKHPEAMKAVKSEVDEVLRETGQEVKRGGPLINLTRDMLLKTPVLDSAVDES
LRMTAAPVLTRAVLEDMSLKMDNGREYKIRKGDRVALFPYTAVQMDPEVHPDPHTFKYNR
FLTPDGGKKTEFYKGGKKVKYYNMPWGAGVSMCPGRFFAVNELKQFVFLMLTYFDFELKN
PDEEIPDIDVRRWGFGTMQPTRDIPFRYRLRF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctactgcaaattcttatcgctctgtttctctctctgcttgggggactttac
gtccttggagccttccgccgtcgaaggtctggagaacctcctctggataaaggtcctctt
ccatggctgggacatgttctggagttcaggagggacacggcgaagtttctagagaggatg
agaaagaagcatggggatattttcactgtgcagctgggagggttttacttcactttcctc
acggacccactgtccttcggctcggtggttaaagaggcccgggccaaactggactttaat
gagttcgctaagcacctggtccagcgtgtttttggctacgatcccttagaagatgaccac
aagctcattcaggcatccagcaacaagcatctgatgggtgatggtctggtgatgataaca
caagccatgatgaacaacctgcagaacctcatgctgcacagtatcaagtctggaaatgat
gatgaaaggctgtggcaggaggatgggctcttcgcttactgctataacatcgtgttccgc
gccggatatctggcgctttttggaaatgaagtagccaagacttcaggaagcgtggacaaa
gcaaaggagctcgaccgaaaggtgtcagatgagctcttttatgagttccgtaaatatgat
caacttttcccaaagctggcttatggagttctgggaccatctgagaaaatggaagcagag
aggctaaagagacttttctggaacgtcctctctgtgaagaaggtgaacaccaaagagaac
attagcggctgggtgtctgaatcacagcagatgcgtgccgagcgtggaatgcatgagtcc
atgcaggacagacacatgttcctgctcctgtgggcgtcccagggtaacacaggtcccgct
tcattctggcttctcctcttcctcatgaagcacccggaggccatgaaggcggtgaagagc
gaggtcgatgaggttctgcgtgaaaccggacaggaggtgaagcgtggtggcccgctgatt
aacctgactcgagacatgctgctcaaaaccccggttctggacagcgccgtggatgagagt
ctgcgaatgacggctgctcccgtgctcacacgagccgttctggaggacatgagcctgaaa
atggacaatgggcgcgaatacaagatccgcaaaggtgaccgtgtggccctcttcccctac
actgctgtccagatggacccggaggtgcaccctgatccacacaccttcaagtacaaccgc
ttcctcacacctgatggtggaaaaaagaccgaattctacaaaggaggaaagaaagtgaag
tactacaacatgccgtggggtgccggggtcagcatgtgtcctgggaggttcttcgccgtc
aacgagctcaagcagttcgtcttcctcatgctcacatattttgactttgagttgaagaac
ccagatgaagagatcccagacatcgatgtgaggcggtggggattcgggaccatgcagcca
acacgtgacatcccattcagatacaggctcaggttttag

DBGET integrated database retrieval system