KEGG   Pangasianodon hypophthalmus (striped catfish): 113524512Help
Entry
113524512         CDS       T05759                                 

Gene name
gucy1b1
Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp01100  Metabolic pathways
phyp04270  Vascular smooth muscle contraction
phyp04540  Gap junction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113524512 (gucy1b1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113524512 (gucy1b1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113524512 (gucy1b1)
Enzymes [BR:phyp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113524512 (gucy1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 113524512
NCBI-ProteinID: XP_026766598
Position
Unknown
AA seq 620 aa AA seqDB search
MFCRRREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKINAGDILQMFGKMFFEFCQES
GYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNSLILHYYSEREG
LQDIVIGIIKTVAQQIHGTEIDMKVIQQKSEECDHIKFLIEEKDSEEEAFYEDLDGFEEN
GTQETRISPYTFCKAFPFHLMFDKDLVLTQCGNAIFRVLPQVRIVFRSIGTLQEDGRQXL
NKTFTFSRTKHHSHKNFHXKEEFFFLKSKEGLLNVESAECEDELTGTEISCLRLKGQMIS
LPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEIL
TDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNA
FCSKHASAEGAIKIVNLLNDIYTKFDILTDSRRNPYVYKVETVGDKYMTVSGLPEPCTHH
AKSICHLALDMMEIAGQVKVDEEPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSR
TETTGEKGKINVSEYTYRCLQSVENADAQFHLEYRGPVTMKGKKEPMKVWFLSRKTFXTD
ADRQDGNSFSFFFKKVVSLQ
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtcgcaggcgggaggcgcaggtggatgtggaaggacagttcctggtcagaatc
atctatgaggacgccaaaacttacgacctggtggctgctgcaagcaaagtgctgaaaatc
aatgcaggagacattctgcagatgtttgggaagatgttcttcgagttctgtcaggagtcc
ggatacgacacgatcctgcgtgtgctcggctccaacgttcgggaattcctgcaaaacctc
gatgctctccacgaccacctcggaaccatctaccccggcatgcgcgctccgtccttccgc
tgcacagacgccgagaagggaaacagcctcatcctgcactattactccgagagagaggga
ctgcaggacatcgtcatcggcatcatcaagaccgtcgcccagcagatccacggcactgag
atcgacatgaaggtgattcagcagaagagtgaggagtgtgaccacatcaagttcctgatt
gaggagaaggactcggaggaggaggcgttttacgaagatctggatggtttcgaggagaac
ggcactcaggagacgcgcatcagtccctacaccttctgcaaggctttccctttccatctg
atgttcgataaagacctcgtcctcactcagtgcggaaacgccatcttcagagtgctgccg
caggtcaggatagtgtttagaagtattggcacccttcaggaggatggacgacaataactg
aacaaaacatttacttttagtcgcactaagcaccactctcataagaacttccattaaaaa
gaggaatttttttttctaaaaagcaaggagggtctgctgaatgtggagagtgctgagtgt
gaggacgagctgacaggaacagagattagctgcctcaggcttaaaggccagatgatttcc
ctccctgagacggagaacatcctgttcctctgctcccccagcgtaatgaacctggatgat
ctgactcggagaggtctgtacctgagcgacatcccgctccacgatgccacgcgggacctg
gtgctgttaggagaacagttccgcgaggagtacaaactcacacaggagctggagatcctc
accgatcgcctgcagcacacactcagagcactggaggacgagaagaagaagacggacagg
ttgttgtactcagttctcccgccgtcggtggcgaacgaactgagacacaaacgtccggtt
cctgctaaacgctacgacaacgtcaccatcctgttcagcggcatcgtgggattcaatgcc
ttctgcagcaaacacgcctcggcagagggagccatcaaaatcgtcaaccttctcaatgac
atctacaccaagttcgacattctgaccgactcacgcaggaatccgtacgtctacaaggtg
gagacggttggtgataagtacatgacggtgagcggacttccagaaccctgcactcatcac
gccaagtccatctgccacctggcactggacatgatggagatcgcagggcaggtgaaggtg
gacgaggaacctgtgcagatcaccattggcatccatactggagaggtggtgacgggggtc
ataggtcagaggatgcctcgctactgcctgttcggcaacacggtgaacctgacgagccgc
acagagaccacgggcgagaaagggaagataaacgtgtcggagtacacatacaggtgtttg
cagtcagtggaaaacgctgatgctcagttccacctcgagtacagaggccccgtgaccatg
aagggcaaaaaggagccgatgaaagtgtggttcctgtcacggaagacattctagaccgac
gcagatcgacaagatggcaatagtttcagttttttttttaaaaaagtggtttcattacag
taa

DBGET integrated database retrieval system