KEGG   Pangasianodon hypophthalmus (striped catfish): 113525428Help
Entry
113525428         CDS       T05759                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase 2-like
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00790  Folate biosynthesis
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    113525428
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phyp04147]
    113525428
Enzymes [BR:phyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     113525428
Exosome [BR:phyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113525428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 113525428
NCBI-ProteinID: XP_026767733
Position
Unknown
AA seq 131 aa AA seqDB search
MSWLMFMRFCTESRSVLSKRRHFLLSAAKMATDSHWLSAAEREHALMELKATGWVELEER
DALYKELHFKTFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVITSTERRSVTPRQAFIKP
QSVFNMSAALS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagctggttaatgtttatgaggttctgcactgaaagtcggagtgttttatccaaacgc
agacactttcttctgtccgcagctaaaatggccacagattcacactggctgagtgcagca
gaaagggagcatgcgctgatggagttgaaggcgacgggatgggtggagctggaggagcga
gatgcactgtataaagagctgcacttcaaaacctttaatcaggcgtttggattcatgtct
cgagtggctctacaggcggagaagatgaaccatcatccggagtggttcaatgtttataat
aaggtaataacttccactgaacgccgctctgtcaccccgcggcaggcgtttataaagcct
cagtcagtgtttaacatgagcgccgcgttgagctga

DBGET integrated database retrieval system