KEGG   Pangasianodon hypophthalmus (striped catfish): 113525525
Entry
113525525         CDS       T05759                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00100  Steroid biosynthesis
phyp01100  Metabolic pathways
Module
phyp_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    113525525 (tm7sf2)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     113525525 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 113525525
NCBI-ProteinID: XP_026767871
Position
Unknown
AA seq 430 aa
MLSALINIRMKSNKHKAPHTTDTEFGGAIGAACLIVLLPLTVLFLLSVCVSAEGAVLRWP
PPLPPHSDLYDPRAVFIIAVWISAHILLYMLPVGKVSEGLVLRDGSRLKYPINGFHALCV
TTVLVCVCVCVGVPLALLYELMVPLAVCAVGVAFLLSLYLYARSFWAPAHALALGGNTGH
AVYDFFMGRELNPRIGSFDLKYFCELRPGLIGWVVLNTVMLLKEVELRGSPSVSMLLVNA
FQLLYVSDALWNEEAVLSTMDIVHDGFGFMLAFGDLVWVPFTYGLQAAFLVSHPHTLTPF
SALAIVLLNGIGYYVFRKSNSQKNQFRRDPTHASVRHLETIATATGKRLLVSGWWGFVRH
PNYLGDLLMALAWSLPCGFSHILPYFYVLYFSVLLVHREARDERQCRAKYGAAWEAYCSR
VPYRIIPYIY
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgctttctgctctgatcaacatcaggatgaagtccaacaaacacaaagcaccacacacc
actgacacggagtttggaggggcgataggtgctgcatgtctaatagtgctcctccccctc
actgtgctcttcctgctgagtgtgtgtgtgtctgcggagggcgctgtgctccgctggccc
cccccactgcccccccactctgacctctacgacccccgagccgtgttcatcatcgctgtg
tggatcagcgcacacattctgctctacatgctcccagtgggcaaggtgtcagagggttta
gttcttagggacggaagcagactgaaatatccgataaacgggttccatgcgctgtgtgtg
acgactgtgttggtgtgtgtgtgtgtgtgtgtgggcgtacccctggctctcctctatgag
ctgatggtgccgttggcggtgtgtgcagtgggcgtggccttcctgctctccctctacctg
tacgctcgctccttctgggctcctgcacacgcactggccctcggaggaaacacaggtcat
gctgtgtatgatttctttatgggacgggagttaaacccgcgtatcggctcatttgatctg
aaatacttctgtgagctgcggccagggttaattggctgggtggtgctgaatacagtgatg
ttgctgaaggaggtggagctcagaggatctccatcagtgtcaatgctgctggtgaacgcc
ttccaattgctctacgtcagcgacgctctgtggaacgaagaggcggtgttgagcaccatg
gacattgtgcatgatggattcggcttcatgttggcttttggtgatttggtttgggttccg
ttcacatacggcctccaggcagcgttccttgtgtcacaccctcatacactcactcccttc
agtgcccttgccatcgtcctgctgaacggaatcggatattacgtcttccgcaagtccaac
tctcagaagaaccagttcaggagagacccaacacatgccagcgtccggcatttagagacg
attgccacggcaacaggaaagcggttgttagtgtctggatggtggggattcgtcagacac
cccaattacctcggagaccttctgatggcgctagcgtggtctctaccctgcggcttctcc
cacattctgccgtacttctatgtgctgtacttcagcgtgttgttggtgcacagggaggcg
cgagacgagcgtcagtgcagagcgaagtacggagcggcctgggaggcgtactgcagccga
gtgccctacaggatcatcccctacatctactga

DBGET integrated database retrieval system