KEGG   Pangasianodon hypophthalmus (striped catfish): 113526327Help
Entry
113526327         CDS       T05759                                 

Gene name
dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phyp04131]
    113526327 (dock8)
Membrane trafficking [BR:phyp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113526327 (dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 113526327
NCBI-ProteinID: XP_026769078
Position
Unknown
AA seq 2087 aa AA seqDB search
MASLPERRAFALKINRHSSAEIRRHFSGLSYGTAQSGLHYRHSSSASGSMCFNVPQSYDA
VEPVDVEEFLMTQLRSGDAELMQELGEFPDDDLEVDLADRECRTAYHSVPEEGVELDPHV
RDCVQSYTQPWLVVNRRCQGDGWSAYSERTGFHKLLQKQIFESDVQPEKQEQPVKSPSLA
VLCDDDSARSTLTSSDFDLRGLQPDPRLDNLLQFSNSEELDRFNLEARQNNRHPELFALY
PPTDEEDAVEIRPIPDCPKEHMGLRMLVRCQAIKFEIEIEPIFATMALYDLKEKKKISEN
FHCDLNTDQMKGLLRSHTPSVDISTLAKAAIFSISYPSPDIYLVIKLEKVLQQGDIGDCA
EPYIGMSESTKNKDKLEKLRSQAENFCQRLGRYRMPFAFGTANIMSAISTPTLDRDMTDS
DSINGKNNMDKKAYLPRRNSERFTTLEDQSNLSSFKPAIITIQSIFKQEGERLSDEDLFK
FLADVKRTSTIQRRVKIIPGFLKVEVTPVPDTVMPCLSPELIPIKPVSEKNLRPIKELLE
FPSNDVYVPHCIYRNLLFVYPQRLNFGHRTLTSAKNITIKIQFMNGEEPLPVIFGKSSGP
EFLSEIYTPVTYHNKSPDFYEEVKIRLPARLTERHHLLFSFFHISCQQKQNQSGSVETLI
GYSWLPMLNNERLQMGAFCLPIVLERLPVNYLLHSPEKLPIQVPPVKWIDGHKGIFSLEI
KAVSSVHTQESHLERFFTLCHALEGKATFPIRVGDEKVPENKLEHELKLSIISLSSSELE
PLVLFLHLVLDKLFCLIMQPMVIAGQTANLAQIAFESVVSVVNSLHNSQELAKDHQGRNC
LLATYLYYVFRLPDTPQEVINTGALIQESRYSTMGRATATSVGSMLLQSRVRSSSNPDIP
APQSSEDAEVKSILVEKGMNHPGSRMSTFIDVTNRYQISASSTRPSNRKQFHEELALQMV
VSTGVCRENVYKYAWFFFELLVKSMAQHVSQMDKQGVSRKNRFSDRFKDDITTIVNVVTA
EIGTILVKQQKEQEQAEKVNISLAFFIYDLMSLMDRGFVFNLVRNYCNQMSAKSVSMSTL
ITMRLEFLRVLCSHEHYLNLSLYFSSPASAPTSPSPSVTSQTSSSCSLPDQKIAAMFDLT
QEFKQQHYLTGLLLTELSAALDMESEGSKVQRKAINATYSLLCAHDLDPRCTRSEVRTKI
AALYLPLVGIIIDSLNYLDFTVSESRGNKAKSSGPEDDFENVTPINQSVAMAIAGNPFNT
LARNALVSMASVSGRSCSTLSAETSRNLLVCFLWIMKNADQSLIQRWIVDISPSQLSRLL
ELLTICTSCFDYRGKQSSDKVSVQALQKSQQAKARLEEALLGGLGARGEMMKRVGANDRT
LGQRENLRWRKDLTQWRQTNDRQDKSKAELDQEAIISGNLATEANLIVLDLLEIIVQTAP
LADYKDSAVGGVLRVLLHSLTCSQSTWYLSHCFSTIRALIVKFGDMLFEEEAEQCADLCQ
KVLQYCSSCVDSNRSQACATLYLIMRYSFSSASNFSRVKMQVTMSLASLVGKSSDVHEEY
LRRSFRTILAYAEEDTEMQSTQLPSQVDELLRNLNSILSDTVKMKEFQEDPEMLMDLMYR
IAKGYQTSPDLRLTWLQNMAEKHNGRKCFTESAMCLVHAAALVAEYLSMLEDHKYLPVGS
VTFQNISPNVLEESAVSDDILSPDEDGVCSGRYFTENGLVGLLEQAAELFSNGGLYEAVN
EVYKIIIPILEAHRDFRKLATTHDNLKRAFENVVQKGPKRMFGTYFRVAFFGSKFGDLDE
REFIYKEPGITHLPEISHRLENFYRQCLGDGVLEMIKDSTPVDRNKLNPNKAYIQITFVE
PYFDGYEMKDRMTNFEKNFNLRRFMYTTPFTKSGRPRGELNEQYKRKTILTTQHAFPYVK
TRINVIQKEEFDLTPIEVAIEDMQNKTRELAIATHKEKPDPKMLQMVLQGSVTATVNQGP
LEVAQVFLNEIPADPKLYRHHNKLRLCFKEFILRCGEAVEKNKLLITPDQREYQHELKKN
YNKLRENLRPMLERKIPELYKPIIKPRLENRDSIKRLSFRRIPEDST
NT seq 6264 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgccggagcgccgggcgttcgcgctcaaaatcaacaggcactcatctgct
gaaatccgcaggcacttcagtgggctcagctatggcactgctcagagcggcctgcactac
cgccacagctccagcgcctctgggtccatgtgtttcaacgttcctcagtcatatgacgca
gtggagccggtggatgtggaggaattcctgatgacacagctgcgcagcggagatgccgag
ctcatgcaggagctgggcgaattccctgatgatgacctggaggtggatttagcggacagg
gaatgtcgaactgcctaccactctgtccccgaggagggggtggaactggatccccatgtg
agagactgtgtgcaaagttacactcagccttggctagtggtcaacagaagatgccaaggg
gatggatggagtgcgtactcggagaggacaggctttcacaaactacttcagaagcaaata
ttcgagtctgacgtccaaccagagaaacaggagcaaccggtgaagtctccgtctttggca
gtgttatgtgatgacgacagcgctcgcagcactctcacctcctctgattttgacctccgg
ggccttcagccggaccctcgtcttgacaacctcctgcagttcagtaactctgaggagctt
gaccgctttaaccttgaagccagacagaacaaccgccatcctgaacttttcgctctctat
ccacctactgatgaggaagatgcagtggaaattcgtcccattcctgactgtccaaaggag
cacatgggcctcaggatgctagtgcgatgccaggccatcaagtttgaaattgagatcgag
cccatttttgccaccatggccttgtatgacctgaaagaaaagaagaagatttcagagaac
ttccactgtgatctaaacacagatcaaatgaaaggcttactgcgctcccacacccctagt
gttgacatctccacactggcaaaggctgccattttctccatctcctacccttctccagac
atctacctggtcattaagttagagaaagtcctgcagcagggggacattggagattgtgca
gaaccatacataggaatgagtgagagcaccaagaacaaagacaaactggagaagcttcga
agtcaggcagagaacttctgtcagaggttgggtcggtacaggatgcccttcgcctttggt
acagccaacatcatgagtgcgatcagcacacccacactggatcgtgacatgaccgactca
gatagcatcaatggcaagaacaatatggataagaaggcttacctgcccagacgcaactca
gagaggttcaccaccctggaggaccagtccaacctgtccagcttcaaacctgccatcata
accattcagtccattttcaaacaggaaggggagcgtctcagtgatgaagacttatttaag
ttcctggctgacgtaaagaggacgtccactattcagcgacgggtcaagataataccaggc
tttctgaaggtagaggtgaccccagtgccagatacagtgatgccatgtctgtctcctgag
cttatccccattaaacctgtatcagagaaaaacctgcgacctatcaaagaacttcttgag
tttccgtccaacgatgtctacgtccctcactgcatatacagaaacctgctgtttgtgtat
cctcagaggctcaactttggccatcgaacgttgacatctgccaagaatattaccataaag
atccagttcatgaatggagaggagccactgcctgttatatttgggaaatcaagtggtcca
gagtttctctcagagatctacaccccagtcacctaccataacaaatctccagatttttat
gaagaggtgaagatccggctgccggctcgtctgaccgagagacaccacctgctcttctcc
ttcttccacatcagctgccagcagaagcagaaccagagcggcagcgtggagactctcatc
ggatactcatggttacctatgctcaataatgaaaggctgcagatgggagctttctgtttg
cccattgttcttgaacgtcttcctgtgaactacttgctacattctcctgagaaattgcca
attcaggttccaccagtcaagtggattgatggtcataaaggaattttcagcttggaaatt
aaggctgtgtcttcagttcatacacaggagagtcacctggagcgcttcttcactctgtgc
catgctctggaggggaaggctacattccctatccgcgtaggggatgagaaagtgccagaa
aacaagctggagcatgagctaaagctcagcatcatctccctgtcctcctccgagctggag
ccacttgtactctttctccacctggtcctggacaagctgttctgcctcatcatgcagccg
atggtcatcgctggccagaccgcaaatctggcacagatagcgtttgagtcagtggtgtcc
gtagtgaacagccttcataacagtcaggaactggccaaggaccaccaaggcaggaactgt
ctcctagcaacctacctctactatgtgttccggttgccagatactccgcaggaagtcatt
aacacaggtgcattgatacaggagagcagatacagcactatgggccgagccacagccaca
agcgtcggcagcatgctgctccaatctcgcgtccgctccagcagcaaccccgatattcct
gctccacagagctcagaggacgctgaggtgaagagcatactggttgagaagggtatgaat
catcccggcagcaggatgtccacttttattgatgttaccaatcgttatcaaatttccgct
agtagcacgcggccctcaaacagaaagcaatttcatgaagagctggctcttcaaatggtg
gtgagcaccggcgtctgcagagagaacgtgtataaatacgcctggttcttctttgagctg
ctggtgaaaagtatggctcagcatgtctctcaaatggacaagcagggagtgtctcgcaaa
aatcgcttttctgaccgcttcaaggatgacatcaccaccatcgtcaacgtggtgacggct
gaaattggcactatactggtgaaacagcagaaggaacaggagcaggctgaaaaggtgaac
attagtctggcatttttcatttatgacctgatgtctctcatggacagaggctttgtcttc
aacctggttaggaactactgcaaccagatgtcagcaaagagtgtgtccatgtcgactctg
atcaccatgaggctggagtttttgagagtgctctgcagtcatgagcactacctgaacctg
agcctgtacttcagtagccctgcgtctgctcccacgtccccttccccgtctgtcacttca
cagacctcgagttcatgtagtttgccggaccagaagattgcagccatgtttgatctgact
caggagttcaaacagcagcactatctgactggcctgctgctgaccgaactcagtgcggct
ctcgatatggaatcagaaggaagtaaggtgcagcgcaaggccataaatgccacatacagc
ctactgtgtgctcatgatttggaccctcggtgcacaaggtcagaagtcaggactaagatt
gctgctctttacctccccctggtgggcatcatcatcgactccctcaactacctggacttc
acagtttctgaatcacgtggcaacaaggccaaatccagcgggccagaggacgactttgaa
aatgtaactcctatcaatcagtctgttgccatggcaatcgcaggaaacccgttcaacacc
ttggcgagaaacgcacttgtgtccatggcctctgtgtcaggtagaagctgtagcacgctc
tctgcagagaccagccgtaatctgctggtgtgtttcttgtggatcatgaagaatgcagac
cagagcctgatccagcgttggatagtggacatatccccttctcagctcagtcgcctcctc
gagctcctcactatctgcacctcctgctttgactacagggggaaacagagctcagataaa
gtgagtgtgcaggccctgcagaagtctcaacaggctaaagctcgtctggaagaggcacta
ctgggaggcctgggagcgaggggagagatgatgaagagggtgggagctaatgaccggact
ctgggccagagagagaacctgcgctggaggaaagacctcacacagtggcgccagaccaac
gacagacaggacaaatctaaagctgagttggaccaggaggccataatcagtgggaatctg
gccactgaggccaacctcatagtcttagacctgctggagatcattgtgcagactgcacca
ctagcagactataaggatagtgcggttggtggagttctgagggttctgctgcactcacta
acatgcagtcagagcacctggtatctatctcactgcttcagcacaatccgagctctcatt
gtgaagttcggggacatgttgttcgaggaggaggccgagcagtgtgcagatctgtgccag
aaagtgcttcagtactgcagcagctgtgtggacagcaacaggagccaggcctgtgctaca
ctctacctcatcatgagatacagctttagttccgccagcaatttctctagagtgaagatg
caggtgaccatgtcgttggcgtctctagtaggaaagtcctcggatgtgcatgaggagtac
ctgcgccgctcttttcgcaccattctagcctatgcagaagaagacacagagatgcaatcc
acacagctgccttcacaggtggatgaacttctgaggaatctaaacagcatcctttcagat
acagtcaaaatgaaagagtttcaagaagatcctgaaatgctaatggaccttatgtatagg
atcgcgaagggctaccagacgtcacctgatctgcgcctgacctggctccagaacatggca
gagaagcataatggcaggaagtgcttcactgagtcagcaatgtgtctggtgcatgctgct
gccctagtggctgagtacctcagcatgctagaggaccacaagtacctgcctgtaggcagc
gtcaccttccaaaacatctcccctaatgttctggaggagtcggcggtgtcagatgatatc
ctgtccccagatgaggacggagtttgttcaggacggtacttcacagagaacggtctggtg
gggcttcttgagcaggctgcagaactctttagcaatggtggattatatgaggcagtgaat
gaggtgtataagatcatcattcccatactggaggcccacagagatttccggaaactggcc
accactcatgacaacctaaaaagagcttttgagaacgtcgttcagaagggtcctaagagg
atgtttgggacatatttccgcgtggcattttttggctcgaagtttggagatctcgatgag
cgagagttcatttataaagaaccaggaatcacacatctccctgagatctcccacagacta
gaaaatttctacagacagtgtttgggagacggtgttctggaaatgatcaaggattccaca
cctgtagacagaaacaaactgaatcccaacaaggcatatattcagatcacgtttgtggag
ccgtactttgacggctatgagatgaaagatcgtatgaccaactttgagaagaacttcaac
ctgcgccggttcatgtacaccaccccgttcaccaagagcggacggcctcgaggagagctg
aacgagcagtacaaaaggaagaccatcctcaccacacagcacgctttcccttatgtgaag
acgcgaatcaatgtcattcagaaggaggagtttgacctcactccgattgaggtggctatc
gaagacatgcagaacaaaactcgcgagctggctatcgccacacacaaagagaagcctgac
cccaagatgctgcagatggtcttgcagggctctgtaacagctacagttaaccagggacca
ttagaggtagcccaggtctttttgaatgaaatcccagcagaccccaaactctaccgtcat
cacaacaaactgcgtctgtgtttcaaagagttcatcctacggtgtggcgaggcagtcgag
aagaacaagctcctgatcacaccagaccagcgagagtatcagcatgagctgaagaagaac
tacaataagctgagggagaacctgaggcccatgctggagaggaagatccctgagctctac
aagcccatcatcaaaccccgtttggagaacagggactcaatcaaacgactcagcttccgg
cggattccggaggacagtacatga

DBGET integrated database retrieval system