KEGG   Pangasianodon hypophthalmus (striped catfish): 113527108Help
Entry
113527108         CDS       T05759                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00010  Glycolysis / Gluconeogenesis
phyp00562  Inositol phosphate metabolism
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113527108 (minpp1)
   00562 Inositol phosphate metabolism
    113527108 (minpp1)
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113527108 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113527108 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Phage_TAC_3
Motif
Other DBs
NCBI-GeneID: 113527108
NCBI-ProteinID: XP_026770427
Position
Unknown
AA seq 461 aa AA seqDB search
MKSAVCRNRHFVIAALSMIMVRVSYCKLTHSSIPAIAVYFGTKGRYEEVNPHLIDDVLFV
NKSLVSPPAADCQAVHLVALIRHGTRFPTTKNIKKLHRLYDVVMTEASGSDQWLSDIQNK
WAMWYTEDMDGQLVEKGKDDLRHLAVRLSKSFPTLISEENLRAERMEFISSSKHRCVDSI
QAFQEGLLKHWDAGDVGFRHYVNDSLMRFFDQCKRFVEDVEHNKTALKEVKLFKSSLEMD
EVCRRVASRLQVPHSHITPDLAEAAFFLCSYEFAIKSKNSPWCKLLDELDAQVLEYKNDL
KQYWKRGYGHDINRKSSCVLFHDVFRRLDQAAYDYRFGEVMKAVTIQVGHAETLLPLLSL
MGFFRDETPLTAKNFLLQHSRKFRSSQIVPYAANLLFVLYDCTDGLRLQFFLNEKPMAFP
NISDPAPLYDTVRKHYSDLLGGCDFKKECELPKDKVKNTEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgcagtgtgcagaaacagacattttgtcattgctgctctgagtatgatcatg
gttcgtgtttcctactgtaagctgacacactcaagcataccagccattgctgtttacttt
gggaccaaaggacgatatgaagaagtgaacccacatttaatagatgatgttttgtttgtg
aataaatctctggtgagtcctccagctgctgactgtcaggcagtgcacttagtggcgctg
atcagacacggcacgcgcttccctacaaccaaaaacattaaaaagctgcaccgcctgtat
gatgtggtgatgactgaggcgtccggctctgaccagtggctcagcgacattcagaacaaa
tgggccatgtggtacactgaggatatggacgggcagctagtagagaaaggcaaggatgac
ctgagacatctggccgtgaggttgagcaagtcgtttcccacactgatttcagaagaaaac
ctccgcgccgagcgcatggagtttataagcagctccaaacacagatgtgtggacagcatc
caggctttccaggagggactcctcaaacactgggatgctggagatgtgggtttcagacac
tacgtgaatgattcactcatgcgcttcttcgatcagtgcaaaagatttgttgaagatgtt
gagcacaacaagaccgccctgaaggaggtcaaacttttcaagtcgtctctggagatggat
gaagtctgcagacgggtggccagtcgcttacaggttccacacagtcatataacaccagat
ttggctgaagccgctttcttcttgtgctcctatgagtttgcaatcaagtctaagaattct
ccgtggtgtaaactgctggatgaattggatgctcaggtcctcgaatacaaaaatgatctg
aaacagtactggaaaaggggatatggccatgacatcaaccgcaaatcgagctgcgtcctc
tttcatgatgtcttcaggaggctcgaccaagcggcgtatgactacaggtttggagaggtg
atgaaggcagttaccattcaggtgggccatgctgagactctgctgcctctgctgtctctg
atgggtttcttcagggacgaaacgccactaacggccaagaacttccttctgcagcacagc
cgcaagttccgcagcagtcaaatagtgccttacgccgcaaacctgctctttgtcctatat
gactgcacagatggactcaggctccagttcttcctcaatgagaaaccaatggcttttcct
aacataagtgacccagctccactgtatgacacagtcaggaaacactactctgatctcctg
ggtggctgtgattttaagaaagaatgtgaattgcctaaagataaagtcaagaacactgaa
ctgtga

DBGET integrated database retrieval system