KEGG   Pangasianodon hypophthalmus (striped catfish): 113527509Help
Entry
113527509         CDS       T05759                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain-like isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04012  ErbB signaling pathway
phyp04020  Calcium signaling pathway
phyp04114  Oocyte meiosis
phyp04217  Necroptosis
phyp04261  Adrenergic signaling in cardiomyocytes
phyp04310  Wnt signaling pathway
phyp04912  GnRH signaling pathway
phyp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113527509
   04310 Wnt signaling pathway
    113527509
   04020 Calcium signaling pathway
    113527509
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113527509
   04217 Necroptosis
    113527509
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113527509
   04916 Melanogenesis
    113527509
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113527509
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113527509
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     113527509
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   113527509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 113527509
NCBI-ProteinID: XP_026771200
Position
Unknown
AA seq 624 aa AA seqDB search
MATIVTSTRFTEDYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLTARDHQKLER
EARICRLLKHPNIVRLHDSIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASQCINQI
LESVNHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAEQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQHTSPAAPTTSTAALAQEACKSLLNKKSDGVKPQTNNTKNSV
VSAVVSALKESNMASSTPMEPQTTVVHNPADGTKGSTESCNTNEEEDMKGRKVESAQGAS
SDSAVMSQCSAGDEPPALVASPQCPPATVVHDIKRMAWNSSGHASCPELEPAQSVPHASA
EGGRSVASAQSRKQEIIKITEQLIEAVNNGDFEAYTRICDPGLTSFEPEALGNLVEGMDF
HKFYFENLLSKNNKPVHTTILNPHVHLIGEDAACIAYIRLTQYIDSQGRPRTCQSEETRV
WHRRDAKWLNVHFHCSGAPAAPLQ
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattgtcacctccaccaggtttacggaagattaccagctttacgaggagctc
gggaagggtgccttttccgtggtgcgcagatgtgtgaagaagtctacaggccaggaatat
gctgctaaaataatcaacacgaagaaattgacagccagagatcaccagaagctggaacga
gaggcccgaatctgtcgtcttctcaaacaccccaatattgtccgactgcatgacagtatt
gcagaagaaggttttcattacctggtctttgaccttgtgactggaggggagctgtttgaa
gacatcgttgccagagagtattacagtgaggctgatgcgagccagtgcatcaatcagatc
ctcgagagcgtcaatcatattcaccagcatgacattgtgcacagagacctcaagcctgag
aacctgctgttggccagtaagatgaagggagcagcagttaagctggctgactttggactg
gcgattgaggtacagggagaccagcaggcatggtttggctttgcaggcactcctggctac
ttatctccagaagtcctgagaaaggacccttatggtaaacctgtggacatttgggcctgt
ggagttatcctctatattcttcttgtgggatatcctccattctgggatgaagatcagcat
aagttgtaccagcaaatcaaggctggtgcctatgattttccttctcctgagtgggacact
gtcacccctgaggccaagaacctcatcaaccagatgctgaccatcaacccagccaagagg
atcactgctgagcaggccctcaagcacccatgggtctgccaacggtctactgtggcctcc
atgatgcatcggcaagagactgtggagtgtctgcgcaagttcaatgcccggagaaaactg
aagggagccatccttaccactatgctggtttccagaaacttttcagtgggccggcagcat
accagccctgctgctcccaccaccagcactgccgcgcttgcacaggaagcatgcaaaagt
ttactcaacaaaaaatcagatggtgttaagccccagacaaacaacactaaaaacagtgta
gtgagtgctgtagtgagtgccctgaaggagagcaacatggcctcctccacaccaatggag
ccacagactacagtagtgcacaacccagcagatggtaccaagggctccacggagagctgc
aataccaatgaggaagaggatatgaaaggtaggaaagtggagagtgctcagggggccagc
agtgacagtgcggtgatgagtcagtgcagtgccggggacgagccgcccgctctggtggca
tcaccacagtgcccaccagccactgtggtgcatgacataaagcgcatggcgtggaacagt
tcaggacatgcctcgtgcccagagttagagcctgctcagtctgttcctcatgcttctgct
gaggggggcaggagtgtggcctcagcccagtctcgtaagcaagagattatcaagatcact
gagcagctaatcgaggccgtgaacaatggagactttgaggcttacacgagaatctgtgac
cctgggctgacttcatttgagcctgaagctctgggtaacctggtggaagggatggatttc
cacaagttttactttgagaacttgttgagtaagaacaataagccagtgcacaccactatc
ctgaacccccatgtgcacctgattggagaggatgcagcgtgtatcgcctacatccgcctg
acgcagtacatcgacagtcagggccgcccgcgcacctgccagtctgaggagacgcgcgtg
tggcaccgccgtgatgccaagtggctcaatgtgcacttccactgctcaggagcaccagct
gcacccttacaatga

DBGET integrated database retrieval system