KEGG   Pangasianodon hypophthalmus (striped catfish): 113527556Help
Entry
113527556         CDS       T05759                                 

Gene name
mapk7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04540  Gap junction
phyp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113527556 (mapk7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113527556 (mapk7)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113527556 (mapk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113527556 (mapk7)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113527556 (mapk7)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113527556 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 113527556
NCBI-ProteinID: XP_026771291
Position
Unknown
AA seq 1152 aa AA seqDB search
MSSSEVEKSKDSVANSKRESNSDKNQQAPELEHHSQPVNDVSTNADASTVAAKNLALLKA
HSLDVKFEVGEEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTNAKRTLRE
LKILKHFKHDNIIAIKDILQPVVPTSAFKSVYVVLDLMESDLHQIIHSKQPLTPEHTRYF
LYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAAHAEESRSFMTEY
VATRWYRAPELMLSLHHYSLAIDLWSVGCIFAEMLGRKQLFPGKHYVHQLQLILSVLGTP
PESVVGAIGAERVRSYVQSLPSRAPVPLTRLFPQAEPVALDLLNAMLRFDPLERISVCQA
LEHPYLAKYHDPDDEPVCVPAFDFEFDRQPMGREQIKEAILAEIQDFHNKKQGSRKIQFK
PLQRLGQGPGSTNNHAYPMVPSTQNQPNVTHPQQQKASQNLVITQSSVTLAPSLNKQAPP
PDFTHLANYLTPFTRSCQDVDMPSANSDGQPETIDLTTPTSSQGTPPCEPTGDCTKREAS
ANQAPAVQTIQSQALHQPSASTAPPSSLTKSGASLSLSQMQAQSLSQSLSRSLGKGGKGT
SGETARKEGAISDDTKAALKAALLKSALRQKARDGSAAALGIDLGSGTASSSSLVSSSGP
EHRRPVTAQERQREREEKRRKRQERAMERKKKMREKEKKEGKSGESLGGVVLSDNDKKLL
ERWGRMMDKSQVIDNNPTNSSNSKTGSCQMQANMGKGLIKMSSDTVESVPDKQPSELQVF
KPPQQIVPQIGQCVASGMFHPRATFNSLSIPLGSTQNGDIGMVAVGGGGGVGGGALAIVG
GGTLGVVAAQCTLAKSDTLKPQPPTQFQGCRTVLTTVGNWTGNQASGGTAQQQAQIPHQS
QQIQLSPPQLSHVSLPQQSVLLTQTQSLPHPQQTQPLMHPQETQPLPSVEMPITNPPVKL
FSSDSFISKPLALTPNGTTRVGIQDTSRSLPTQDSVHASEPLEKLCSALGKQQNGTPSHE
PSHGAPGSSAQTCLTDTGLPVSSRAPDIHTVTLQLSKSQVDDILPPVFSVTPKGSGAGYG
VGFDLDELLTQSLTDLQHSDLRESHNDSAPLSASLLSDWLEVHRMTPADLESLQQELQLG
SPMILSDNSNLP
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccagtgaagttgagaaatcaaaagactctgtagccaacagtaagagggagagt
aacagtgacaagaatcaacaagcacctgagctggaacatcactcccaacctgtcaacgat
gtgtcaaccaatgcagatgcaagtactgtggctgcgaagaacctggcacttcttaaagcc
cattctttagatgtgaagtttgaggttggtgaagagtatgacataatcgagaccattggc
acaggtgcctatggcgtcgtatcatctgccaggaggcgggacaatgggcaacaggtggca
ataaagaagatcccaaatgcctttgaagttgtgacaaatgccaaacgcacacttcgagag
ctcaagatcctgaaacactttaaacatgacaacattattgcaattaaggacatccttcag
cctgtggtacctacctcagccttcaaatcagtgtatgtagtccttgacctaatggagagt
gacctgcatcagatcatccactcaaaacaacctctgacccctgagcacacacgctacttt
ctgtaccagctgttgcgtggcctaaagtacatccactcagccaatgtaatccaccgcgac
ctgaagccgtccaacctgctggtgaatgagaactgtgagctgaaaattggggactttggc
atggcccggggtttgagtgctgcccatgctgaggagtcacgttccttcatgacagagtat
gtggccacacgttggtaccgtgcacccgagctcatgctctcacttcaccactacagcctt
gccattgacctctggtcagtaggatgcatcttcgccgagatgctgggtcggaagcagctc
ttcccaggcaagcactatgtgcatcagctgcagctgattctctccgtcttgggtacacct
cctgagagtgtggtgggtgctattggagcagaaagggtgcgctcttacgtccagagcttg
ccttccagggcacccgtgcccctcaccagactgttcccacaggctgaacctgttgctctg
gaccttctgaatgccatgctgcgctttgaccctctcgaacggattagtgtctgccaggca
ctagagcacccttaccttgccaagtaccatgacccagatgatgagcctgtgtgtgtgcct
gccttcgattttgagtttgaccgacagcccatggggcgagagcagatcaaggaggccata
cttgctgaaatacaggacttccacaacaagaaacaaggtagcaggaagatccagttcaaa
ccactccagagattgggacaagggccagggagcacaaataatcatgcctatccaatggtg
cccagtactcaaaaccagccaaatgttacacaccctcagcagcagaaagcaagtcaaaat
ttggtcataacacagagctcagtcaccttggctccttcattaaataagcaagctcctcca
cctgattttacccatcttgccaattatttgacaccattcacaagaagctgtcaggatgtg
gacatgcccagtgcaaattcagatggacaaccagagaccatagaccttaccactcccaca
tccagccaaggcacaccaccttgtgaaccaactggagactgcaccaagagggaggcttct
gcaaatcaagctcctgctgtacagacaattcagagccaggcactccaccagccatcagcc
tctacagcacctccatccagtcttacaaaatctggggcctccctttctctatctcagatg
caagctcagtctctctctcagtcactttctcgttcacttggaaaaggggggaaaggaact
tctggggagaccgctagaaaagaaggggcaatttcagatgataccaaagcagcactcaaa
gcagctttgctcaagtcagcactaaggcaaaaggcacgagatggaagtgctgcagccctg
ggtatagacctgggcagcggaactgcaagctcatcttccttggtttcgtcctctggtcca
gaacacaggagacctgttacagcacaagagagacagcgggagagagaagagaaacgaagg
aaaagacaggaacgagcaatggagcgaaagaaaaagatgagagaaaaggagaaaaaagaa
ggcaaatcaggcgagtccttgggtggcgtcgtgctgagtgacaatgacaagaagctgctg
gaacggtggggacgaatgatggacaaatcacaggtcatcgacaataatcctactaactcc
agtaacagtaagacaggttcttgccagatgcaggcaaacatgggaaaaggcctgataaag
atgtcatcagacactgtggaatcagtgccagacaaacaaccaagtgagttgcaggtgttc
aaaccaccccaacaaatagtgcctcagattggccagtgtgtggcatctggaatgtttcat
ccacgtgccaccttcaattccctgtcaattcccctagggtccactcaaaatggggacatt
gggatggtggcagttggtggaggtggaggtgtagggggtggggctctggccatagttgga
ggtgggacacttggtgtggttgcagcccaatgtacccttgccaaaagtgacaccttaaaa
ccccaacctccgactcagttccaggggtgtcggacagtattaaccacagtagggaactgg
acagggaaccaggccagtggaggaacagcacagcagcaagcacaaataccacaccagtct
cagcagatccagctgtctcctccacagctgagccatgtgagcttaccccagcagtcagtt
ctgctcactcaaacccagtctcttccacacccccagcaaacccaacctcttatgcacccc
caagaaactcagcctcttcctagcgttgaaatgcccatcactaaccctcctgtcaaactc
ttctcatcagactccttcattagcaaacctctagcattgactcccaatgggacgacaaga
gttggaattcaggacaccagcaggtctctgcctacccaggactcagtacatgcttctgag
cccctggagaagttgtgttctgcccttggcaagcagcaaaatggtactccttcacatgaa
ccttctcatggggcacctggatcatcagcccaaacctgcctgacggacacggggctacca
gtgagctccagagcaccagacatccatacagtcacactacagctgtctaagtcacaggtt
gacgatattttgcccccagttttttctgtgacccccaagggcagtggggctggatatggc
gtcggctttgatcttgacgagcttcttactcagtcgctcactgacctccagcactcagac
ctcagggaaagtcacaacgactctgcacccctctccgcatccttgctctcagattggttg
gaagtacaccgcatgaccccagccgacttggaatcactgcagcaggagcttcagcttgga
tctcccatgattctttctgacaactccaacctcccttag

DBGET integrated database retrieval system