KEGG   Pangasianodon hypophthalmus (striped catfish): 113527684Help
Entry
113527684         CDS       T05759                                 

Gene name
wnk4
Definition
(RefSeq) serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113527684 (wnk4)
   01009 Protein phosphatases and associated proteins [BR:phyp01009]
    113527684 (wnk4)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113527684 (wnk4)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: Other
  Wnk family
   113527684 (wnk4)
Protein phosphatases and associated proteins [BR:phyp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113527684 (wnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C LepA_C
Motif
Other DBs
NCBI-GeneID: 113527684
NCBI-ProteinID: XP_026771511
Position
Unknown
AA seq 1525 aa AA seqDB search
MSHAEVEVSGLGFASLPVDLDADCLSRVPPLRAHALSARRNSYVLHKLELEPQFFSAPSS
WSEENVLTEGRTEETKAVETPPSPASPQSSPSKAQWDAAVPVAGAHEASSDSDTEPRKSS
PKLVKRLESRWEQEEKEDVETKAVATSPDGRYLKFNVEIGRGSFKTVYKGLDTETTVEVA
WCELQTRKLTKVERQRFSEEVEMLKNLQHPNIVRFYDSWKSTVKGHKCVLLVTELMTSGT
LKTYLKRFKEMKPKLLQRWSRQILKGLHFLHTRAPPIIHRDLKCDNIFITGPTGSVKIGD
LGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMTTSEYPYSECQNA
AQIYRKVTSGVKPDSFYKVKVPELKEIIEGCIRMNKDERYTIQDLLEHVFFQEHNGVRVE
LAEEDDMEKSSLKLWLRMDGTKKLHGKYKDNNAIEFLFELYKDVPEEVAQEMVVLGFVCE
ADYKLVAKAMRDRVTAIKRQRERQRRIREEEKKKQEETIEEEPESPLPKPTGQVLDSPAS
SPVQIPPTLPLHDPSAVSPVISPDCGINEGFLQEPEEPEADQHFHIRHTSYSSITSDCET
DGYLSPSGFQDGLDAAIGNICSPSTPPSNLATPPITPTSTPPMPLLRFPSSIAVCNTIDK
KVSGPPSPFSSSVDSYASDVTSGLSDGYEGQSERCSKSAGRRTAGRLFKRRARSRLRITG
LSDKVDRVVECQLQTHNDKMVTFKFDLDGDNPEDIAAVMVRNEFILPSERDGFIHRIRDI
IKKAESLMGKDLAGQQVKQEGMHFPQHTPASSISSSQPNLHNLARTHSTSSLPESRGSVA
GQNGDITSPARPLLRSQSFHNTLGTSRPFHTTYPSDPTMSLSNLGHIPQFPMPIMTTSAQ
LPYLYPPNPGSPKTAHPSRSHFPSNPSHFMSASSGPHVSDSTSPIADGNPMTSHMPTIWA
PQTPPLFSLANMLSMAMSMAQSFIPPPNLPTPMVTPMPSLPGFPPHFSHALPPQAGYPMA
YAPHYTLPVQAEGIYPPCNTDAQNLNRDAMYGFAQRTHSTFTHAPGMPTQTDSHVQQISS
SVSQKAVQGSLPTHIQHHPTDYSLPHVYTEAFPRPSLDQTSLSRSSSSGLSSSPRPSPES
MVSSSSPRSLSPSAEPDTSTSMCELRESPVSSEPKPVVTVGRFQVSPTKEIPPLSSLADK
SPNTTPDLTPVVSPDMPTNISICSSHDNQTKGQTGLDKNEVTSITTTFSQHLHIDVPQAQ
HFSLNATHDQSQSLGLEQKLLSEVPHDAFGLHEQSQQDSKMTWTDETKEEEKEEAQQSGD
EEPDKDDKVQEEQEQRKKKTRRLGSVQSLTGTSVDSGLCVIVDPDGSQREGIMDSPQCLV
PHHNMWMNYIRTNSYMSSDESESEDEEMWDELQELREKHLFEVQTLQAVQKREIEELYER
MGKIPPPCILSPATMLSSRQRRLSKGGGFPSSRRNSLQRLDILPITGIIRKNSVSGGSSS
SSSSHELPAKGVTFTSDLTRMVCST
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatgcagaagtggaggtgtctggtctcggctttgcgagtttacctgttgatctg
gacgcggactgtctgtcccgagtgccgccgcttcgagcgcacgcgctcagcgccaggagg
aactcgtacgtgcttcacaaactggagctcgagccgcagtttttcagcgcgccttcatca
tggtccgaagaaaatgtcttaaccgaaggacggacggaggaaaccaaagctgtcgagacg
ccgccatccccggcgtctccgcagtcctcaccgtccaaagcgcagtgggacgccgcggtt
ccggtggccggtgcgcacgaggcgagctcggattcagacaccgagcccaggaagagcagc
ccaaagctggtcaaaagactcgaaagccgatgggagcaagaggagaaggaggacgtggag
accaaagccgtggctacgtctcccgatggccgatacctgaagtttaacgtggagatcggc
agaggctcgtttaagaccgtgtataagggtctggacacggagaccacagtggaggtggcg
tggtgcgagctgcagacaaggaaactgaccaaagtggaacgccagcggttcagcgaggag
gtggagatgctgaagaacctccagcacccaaacattgttcgcttttatgactcctggaag
tccacagtgaaaggacacaagtgcgtcctgctagtcacagaacttatgacctccggcacc
ctcaaaacgtacctgaaacgctttaaggaaatgaagcctaagcttcttcagcgctggagc
cgtcagatactaaaagggctccacttcctgcacactcgagctcctcccatcatccacaga
gacctgaaatgtgacaacatcttcattacgggacccacagggagcgtgaaaattggtgat
ctcggacttgctacactcaaaagagcatcgtttgctaagagtgtaattggaacaccagag
tttatggctccagagatgtatgaggagaaatacgatgaggcggttgatgtgtacgcattt
gggatgtgcatcttagagatgactacatcagaatacccgtactcagaatgccaaaacgcg
gcacaaatctaccgcaaagtcacaagtggcgtgaaaccagacagcttctacaaggtgaaa
gtgcctgagctgaaagagattatagaaggatgcatacgtatgaacaaagatgaaagatac
accattcaggacctgctggagcacgtattcttccaggagcacaatggtgtgcgtgtggag
ctggcagaagaggatgacatggagaagtccagcctgaagctctggctgcgcatggatggc
accaagaagctccatggaaagtacaaggacaacaatgctatcgagttcctgttcgagctc
tacaaggacgtgcctgaagaggtggcacaggagatggtggtgctgggatttgtatgcgag
gctgactacaaattggtcgccaaggcaatgcgggaccgagtgacagccatcaaacgccaa
cgcgagagacagcgtcggatacgtgaggaggagaagaagaagcaggaggagaccattgag
gaggaacccgagtcacctttgccgaagcccactggccaagtgcttgatagccccgcctcg
tccccagtgcagatcccacccactctgcctcttcatgacccttctgctgtctctccagtt
atctccccagattgtgggatcaatgagggctttttacaagagccagaagaaccagaggct
gaccaacactttcacatccgccacaccagctattcttcaattacatctgattgtgagaca
gacgggtatctcagtccctctggctttcaagatgggcttgatgctgctataggaaatatt
tgcagcccttctactccaccctctaatttggccacaccccccatcacacccacctcaact
ccaccaatgccgcttctccgctttccctcaagcattgctgtatgtaatactatcgacaaa
aaagtatcagggcctcccagtcctttctcctcgtctgtggacagctatgcctcggatgtg
acctcaggtttgagtgacggctacgagggccaatcagagaggtgcagtaagtcagctggc
cgacggacagcagggagactgttcaagagaagggcccggtcccgtctgcgcattacaggg
ctatctgataaagtggaccgggtggtggagtgtcagcttcagacacacaatgataaaatg
gtcaccttcaaatttgacctcgatggtgacaaccctgaagacatcgctgctgttatggtg
cgtaacgagttcatccttccctctgagagagatggctttattcaccgaatacgtgacatc
atcaagaaggcagagtctctaatgggcaaagatttggctgggcagcaggtcaaacaagaa
ggcatgcatttcccacagcatacccctgccagctccatttcctcatcgcagccaaacctg
cacaatcttgctcggacacattccacctcctctctgccagagtcccgtggctcagtagca
gggcagaacggagacattacatcaccagcacgtcccctcttacgttcacagtccttccat
aacacactgggaacttcacgtccattccataccacgtacccgtccgatcccaccatgtcc
ctttcaaatcttggccacatcccgcagtttccaatgcccattatgaccacctctgctcaa
cttccctatttgtacccaccaaatcctggctcccccaagactgctcatccctcacggtca
cacttccccagtaacccctcccacttcatgtctgcctcttctggccctcatgtctcagat
tccaccagccctattgccgatggcaatcccatgacctcacacatgcccaccatatgggcg
ccgcaaacgcctccacttttctccttggcaaacatgctgtccatggccatgagcatggct
cagtccttcatccctccccctaacctgccaacccctatggtgacacccatgccctctctt
cctggctttcctccacacttcagccatgctctgccaccccaggctgggtatcccatggca
tatgcaccccactatacactgcctgtgcaagcagagggcatatacccaccatgcaataca
gatgcccaaaatctgaatcgggatgctatgtacgggtttgctcaaaggacacattccaca
tttacacatgcacctgggatgcccacgcaaacagattctcatgtgcagcaaatatccagc
agtgtctcacagaaagcggttcagggtagtcttcctacacacatccaacaccaccctacg
gactattctctgccacatgtatatactgaagcttttcccagaccttcactggaccaaaca
agcctgtccagatcatcttcctccggactgtcatcttccccaagacccagtccagagagc
atggtttcttcctccagtccaagatccctttccccatcggcagaaccagacactagtacc
agtatgtgtgagctcagagaatcccctgtcagctctgagccaaaaccagtcgttacagtt
gggcggttccaggtttcacctacaaaggagatcccacctctctcttcacttgctgacaaa
agccccaacactactcctgacctgacaccagttgtttcaccagacatgccaaccaacatt
tccatttgttcctcccatgataatcaaactaaagggcaaacagggttagacaaaaatgaa
gtcacatcaataaccaccaccttctctcagcacctccacatagatgttcctcaagctcaa
cacttctccttgaatgctactcatgaccaaagtcaatcattgggccttgagcagaagttg
ttgtctgaggtgcctcatgatgctttcggcctccatgaacaatctcaacaagatagtaaa
atgacctggactgatgagaccaaagaagaagagaaagaagaagcacagcagagtggtgac
gaggagccagacaaagatgacaaggtccaggaggagcaggagcagaggaagaagaaaacc
cgaaggcttggttctgtacagtctctgactgggacatcagtggacagcgggctttgcgtc
attgtggatccagatgggagtcagcgggaagggattatggacagtcctcaatgtcttgtc
cctcaccacaacatgtggatgaactacatacgcaccaattcctacatgagcagtgatgaa
tctgaaagtgaagatgaggagatgtgggatgagctgcaggagctgagagagaagcatttg
tttgaggtgcagactctgcaggcggtacagaagcgagaaatagaggagctctatgagcgg
atggggaaaattcctcctccatgcatcctctcaccagcaaccatgttgtccagtcggcaa
cgtcggctgtctaagggaggaggctttccttcatctcgtcgcaacagccttcagagactg
gatattctccctataacagggataataagaaagaattctgtaagtggcggcagcagcagc
agcagcagttcacatgaactacctgctaaaggggtgaccttcacttctgaccttaccaga
atggtatgctccacctaa

DBGET integrated database retrieval system