KEGG   Pangasianodon hypophthalmus (striped catfish): 113528141Help
Entry
113528141         CDS       T05759                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp03040  Spliceosome
phyp04010  MAPK signaling pathway
phyp04141  Protein processing in endoplasmic reticulum
phyp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113528141
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113528141
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113528141
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113528141
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phyp01009]
    113528141
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:phyp03041]
    113528141
   03009 Ribosome biogenesis [BR:phyp03009]
    113528141
   03110 Chaperones and folding catalysts [BR:phyp03110]
    113528141
   04131 Membrane trafficking [BR:phyp04131]
    113528141
   03051 Proteasome [BR:phyp03051]
    113528141
   03029 Mitochondrial biogenesis [BR:phyp03029]
    113528141
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phyp04147]
    113528141
Protein phosphatases and associated proteins [BR:phyp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113528141
Spliceosome [BR:phyp03041]
 Complex B
  Other components
   Prp19 complex
    113528141
 Complex C
   Prp19-CDC5 complex
    113528141
Ribosome biogenesis [BR:phyp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113528141
Chaperones and folding catalysts [BR:phyp03110]
 Heat shock proteins
  HSP70 / DNAK
   113528141
Membrane trafficking [BR:phyp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113528141
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113528141
Proteasome [BR:phyp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113528141
Mitochondrial biogenesis [BR:phyp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113528141
Exosome [BR:phyp04147]
 Exosomal proteins
  Proteins found in most exosomes
   113528141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 113528141
NCBI-ProteinID: XP_026772333
Position
Unknown
AA seq 643 aa AA seqDB search
MSSAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPSNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVTSDGGKPKVQVEYKGEEKSFYPEE
ISSMVLVKMKEIAEAYLGQRVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKKGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGTDFYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTTLIKRNT
TIPTKQTQVFSTYADNQPGVLIQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTF
DIDANGILNVSAXDKSTGKENKITITNDKGRLSKEEIERMVQEADKYKAEDDRQREKIAA
KNSLESYAFNMKNSVEDESMKGKISEEDKKKVIERCNQAITWLENNQLAEKEEFEHELKE
LEKVCNPIITKLYQGGMPAGSCGAQARSTSGANTQGPTIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgctaaaggaattgctattgggattgacctgggcaccacctactcctgtgtg
ggggtgtttcagcatggaaaggtggagatcattgctaatgaccagggaaacagaacaaca
cccagctacgtggccttcacagacacagagaggctcattggagatgctgcgaaaaaccaa
gtggccatgaaccccagcaacacagtgtttgatgccaagaggctgattggcaggaagttt
gacgacccagtcgtacagtccgacatgaagcattggcctttccaagtgaccagcgatgga
ggcaagccgaaggttcaagtcgagtacaaaggggaggagaagtccttttaccctgaagag
atctcttccatggttctggtgaaaatgaaggaaatcgcagaggcctatcttggacagagg
gtaacaaatgctgttattactgttcctgcctacttcaatgactctcagagacaagccact
aaagatgctggagtgattgctggactgaacgtcctgaggatcatcaacgagcccacagct
gcggcgatcgcctacggcctggacaaaggcaagaaaggagagcgcaatgtcctgatcttc
gatctgggaggtggtaccttcgatgtgtctatcctgaccattgaagatggcatctttgaa
gtgaaagccacagcaggagacactcacttgggtggagaggactttgacaaccgcctggtc
aaccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcga
gccctgaggaggctgcgtactgcctgtgagagagccaagagaaccctatcctccagctct
caagccagcattgaaatcgactcgctgtatgagggcactgacttttacacttctatcacc
agagcacgctttgaagagttgtgttcagacctgttcagaggaacactagagccggtggag
aaagccttgagagatgccaagatggacaagtcccagatccatgaaattgtcctggttgga
ggttctacaagaatccccaagatccagaaacttctgcaggacttctttaatggacgggaa
ctgaacaaaagcatcaacccagacgaggcggtagcttacggtgctgcggttcaggctgcc
atccttatgggcgacacctctggaaacgtccaggacctgttgctgctggatgtggctcca
ctgtcgctgggcattgagacagcaggaggagtcatgaccactctcatcaaacgcaacacc
accatccccaccaagcagacgcaagtcttcagcacgtacgcagacaaccagcctggggtt
ctgatccaggtgtatgagggagagagagccatgaccaaagacaacaacctactggggaag
tttgatctgacgggcatcccacctgcaccgcgtggagttcctcagatcgaagtgaccttt
gacatcgacgccaacggcattctgaacgtgtctgctngtgacaaaagcaccggcaaagag
aacaagatcaccatcaccaatgacaagggcaggctgagcaaggaggagattgagaggatg
gtgcaggaagcagataagtacaaagcagaggatgaccgtcagcgagagaagattgcagcc
aagaactccctggagtcgtatgcctttaacatgaaaaacagtgtggaagatgaaagcatg
aaaggcaaaatcagtgaagaggacaagaagaaagtgattgagaggtgtaaccaggccatt
acctggctggagaacaaccagctggctgaaaaggaggagttcgaacatgagctgaaggaa
ctggagaaagtctgcaaccccatcatcactaagctgtaccagggagggatgccagctgga
agctgtggagctcaggcacgatccacttcaggagcaaacacccagggaccaactattgaa
gaagtggattaa

DBGET integrated database retrieval system