KEGG   Pangasianodon hypophthalmus (striped catfish): 113528918
Entry
113528918         CDS       T05759                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
phyp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113528918 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113528918 (apln)
SSDB
Motif
Pfam: Apelin DIM
Other DBs
NCBI-GeneID: 113528918
NCBI-ProteinID: XP_026773564
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLLSLLCSARAGPVTSTEHSKELEEVGSMRTPVRQNAARAGRNQRPSGW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctgctgctttctctgctgtgttcagcc
cgtgctggtccagtgacctccaccgagcatagcaaggagctggaggaggtgggtagcatg
aggactcctgtgcgtcagaacgctgcccgagctggccggaaccaaagaccctccggctgg
aggaggaggcgccctcgaccccgtctgtcccacaaggggcccatgccattttag

DBGET integrated database retrieval system