KEGG   Pangasianodon hypophthalmus (striped catfish): 113528999Help
Entry
113528999         CDS       T05759                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04020  Calcium signaling pathway
phyp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113528999 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113528999 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phyp04030]
    113528999 (htr4)
G protein-coupled receptors [BR:phyp04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    113528999 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 113528999
NCBI-ProteinID: XP_026773702
Position
Unknown
AA seq 428 aa AA seqDB search
MRGCAFPHEGLEPCHGFDPRSPHENETLFFYGYMNLSSSGQMPVMEEVDTSESNGMAKRV
ALISFLSLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIE
LIHQNWIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRVAL
MIGGCWIIPTVISFLPIMQGWNSIGINDLIEARKFTGNSTVCVFMVNKPYALTCSVVAFY
IPLGLMVLAYQRIYVTAREHARQISMLQRAGGAVSGPESAEHQRNHRMRTETKAAKTLCI
IMGCFCLCWAPFFITNVVDPFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAF
LIILCCGHQRYRRPSILAPRTPCTATQINGSTHVLKPYIKAKLGFSIHGCSSASKLLLWF
CNTKPVPV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggatgtgctttcccacatgagggtttagaaccgtgccatggttttgacccgagg
tctcctcatgaaaatgagacgctgttcttctatgggtacatgaatctgagttccagcggc
cagatgcctgtgatggaggaagtcgataccagtgagagcaacggcatggcgaagagagtt
gctctcatcagcttcctgtcgctggtcatgcttatgagcgtcctgggaaacctactggtc
atggtggcagtctgcaaggaccggcaactcaggaaaattaagaccaattacttcatagtg
tcgctggcctttgctgacctgctggtatcagtgctagtgatgccgtttggggccatcgag
ctaatccatcagaactggatctatggcgagacgttctgcctggtgcgcacctcactggac
gtgctactcacaactgcctccatcctgcacctgtgctgcatatctctggacaggtactat
gccatctgttgtcagcctctggtctacaggaacaagatgacaccactgagagttgctctt
atgataggaggatgctggattatcccaactgttatatccttcttaccgattatgcaaggc
tggaacagtattggaataaatgatttgatagaggcgcggaagttcactggcaactccacg
gtgtgcgtgttcatggtgaacaagccatatgcactcacctgctctgtggtggccttctac
atcccactgggtctgatggtgcttgcctaccaacgcatctatgtaacggcacgtgaacat
gcccgtcagatcagcatgctgcagagggcaggtggcgcagtctccggccctgagagtgct
gaacaccagcgcaaccaccgcatgcgcactgagaccaaggcggcaaagactctgtgcatc
attatgggctgcttttgcctgtgctgggctccattcttcatcactaacgtggtggaccct
ttcatagactacacagtgcccgagcagctgtgggcagcatgcctgtggctgggctacatc
aactccatgctaaaccccatcctctatgccttcctcaacaagtccttccgccgtgccttc
ctcatcatcctctgctgcggccaccagcgataccgacggccctccatccttgcacctaga
acaccctgcacagctacacagatcaacggctccacacacgtgctcaagccatacattaaa
gcaaaacttggctttagtatacacggctgctcctctgcttctaaactcctactctggttc
tgcaacactaagcctgttcctgtctag

DBGET integrated database retrieval system