KEGG   Pangasianodon hypophthalmus (striped catfish): 113529157Help
Entry
113529157         CDS       T05759                                 

Gene name
dnase2b
Definition
(RefSeq) deoxyribonuclease-2-beta
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    113529157 (dnase2b)
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     113529157 (dnase2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 113529157
NCBI-ProteinID: XP_026773960
Position
Unknown
AA seq 351 aa AA seqDB search
MLLLRSFCLIFFLVFFFLGSLCEGEISCLNEDGQPVDWFIMYKLPRYKQGNVGSGVDYMY
LDPSLPNWQMSKHAVNTSEGALGRTLSQLYQIYKSNSSAYMLYNDAPPVLKYENNYGHTK
GALLFDQFQGFWLIHSIPHFPPFPEMGFGYPSTGKLYGQSVQCTTYSYKQFQKICKQXXX
INPYVYNCSMPSAYYTDMAEMAQICAGKTVTVVPRRRLEKLISVKGETFLSFAKSHSYVD
DIYAGWIAQTLKTDLLVETWQRQAHQLPSNCSLPYHVMNIRRVSLSELVTFSSYEDHSKW
CVSWEYQTQWTCLGDLNRESRQAWRGGGLICTQNSAVYKAFRSAVAWYKHC
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgttgcggtcgttttgtctgattttcttcctggtattcttcttcttaggctca
ctgtgtgagggtgaaatctcctgcttaaatgaagatgggcagcctgttgactggttcatc
atgtacaaattaccaagatataaacaaggtaatgtgggaagtggagttgactacatgtat
ttggatccctcattacccaactggcagatgagtaaacatgcggtgaataccagtgaaggg
gcattaggcaggacactcagccagctgtaccaaatatacaagtcaaacagctccgcatac
atgctctacaatgatgctcctccggtgctgaagtacgagaataattatggacacacaaaa
ggggcactgctttttgaccagtttcaaggattctggttaatacacagcattcctcacttt
ccacctttccctgaaatgggttttggctatccatccactggaaaactctacggccagagt
gttcagtgtacgacctacagttacaaacagttccaaaaaatatgtaagcaannnnnnnnn
attaatccatatgtatacaactgctcaatgccatcagcctactacacagatatggcagaa
atggcacagatctgtgctggcaaaactgtgactgtggttcccaggagaaggcttgaaaag
ctgatatcagtcaagggagagactttcctcagttttgccaaatcacacagctatgttgat
gacatttatgctggctggatagcacagacactgaagacagacttgctagtggaaacatgg
cagcgacaagcgcaccagcttccctccaactgctcacttccttaccatgtaatgaacatc
aggagggtcagtctatctgagctggtgactttcagctcctatgaagaccattccaagtgg
tgtgtctcttgggaataccaaacccagtggacttgtctaggggacttgaacagagagagc
agacaggcatggcgaggaggtggcctcatctgtacacaaaattcagccgtgtacaaagct
ttccgttcagctgtggcctggtataaacattgttag

DBGET integrated database retrieval system