KEGG   Pangasianodon hypophthalmus (striped catfish): 113530630Help
Entry
113530630         CDS       T05759                                 

Definition
(RefSeq) activin receptor type-1-like isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04060  Cytokine-cytokine receptor interaction
phyp04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113530630
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113530630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113530630
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     113530630
Protein kinases [BR:phyp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   113530630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS TMEM154 APH Haspin_kinase EphA2_TM FTA2
Motif
Other DBs
NCBI-GeneID: 113530630
NCBI-ProteinID: XP_026776599
Position
Unknown
AA seq 502 aa AA seqDB search
MSFFFVLPTEMEAAAGFLLLLTLMALRVNTVHTAQSTDRRVNCACENACTDTCTGYICFF
TSNHGQVVRGCFEKEQQEQCMVFGIPNVFAKCCRSDYCNANMTVPKDPVKPSESGSVIVL
VAVPLLVLLLLSIAVCVFVLWLRSKRQHRHPQERDPPMLKVPSGGDPTYGDIFDEFCTSG
SGTGLPYLVQRTMARQISLVECVGKGRYGEVWRGTWMGENVAVKIFSSRDEQSWFRETEI
YNTVQLRHENILGFIASDMTSKNSSTQLWLVTHFHELGSLYDFLQYSTLDPEACLCMCLS
IASGLVHLHTEILTTQGKPAIAHRDLKSRNILVKRNGQCCIADLGLAVIHSQSNDYLDVG
NNPRVGTKRYMAPEVLDESIRVDIFESYKQTDIWALGLVLWEITRRTIVNGIVEEYRLPF
FDVVPSDPSFEEMKKVVCVDQYRPCLHNRLHSHPILSAIAKIMKECWFQSPSARLTALRV
RKTLAKLDQDQDCSTDKLKLDV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttttttgttttgcccacagagatggaggctgctgcaggattcctgctgctg
ctcactttgatggctttaagagtaaacacagttcacacagcccaaagcacagacagaagg
gtgaactgtgcatgtgaaaacgcatgtacagacacttgtacagggtatatctgcttcttc
acctcgaaccacgggcaggtagtgaggggctgctttgagaaggagcagcaggagcagtgc
atggtctttgggatccccaacgtgttcgccaagtgttgccgctctgactactgcaacgcc
aacatgacagtacccaaggatccagtaaagccaagtgaatctggcagtgtgattgtgctg
gtggctgtgcctctgctggtgctgcttttgttgtccatagcagtgtgtgtctttgtgttg
tggctacgctccaaacgacagcaccgccatccgcaggaacgtgacccccccatgctcaaa
gtgcccagtggaggagacccaacttatggggatatctttgatgagttttgcacatcaggc
agtgggaccggcttgccttacctggtgcagaggaccatggctaggcagatctccttagtg
gagtgtgttggtaaggggcgttatggagaggtgtggaggggcacgtggatgggagagaac
gtggctgtgaaaatcttctcatctcgagatgaacagtcctggttcagagagactgaaatc
tacaacactgtccagctaagacatgaaaacatcttaggattcattgcctcagacatgaca
tcaaagaactccagcacacagctctggctggtgactcatttccatgagctgggctctctc
tatgacttcctgcagtacagcaccttggatccagaggcatgtttgtgcatgtgcctatcg
atagccagtggtctggtgcacctccacacagaaatcctcaccactcagggcaagccggcc
atcgcccaccgtgacctcaaaagccgcaacatcctggtgaagaggaatggccaatgctgc
atcgctgacctgggtctggctgtcattcattctcagtccaacgactacctggatgtaggg
aacaacccaagggtgggcaccaaacgctacatggcccctgaggtcctagatgagagtatc
cgtgtggacatctttgaatcatataagcagactgatatctgggctttgggactggttttg
tgggagatcacccgccgaaccatcgtaaatggaattgtcgaggagtatcgcctgcctttt
tttgacgtggtgccctccgacccaagttttgaagagatgaagaaagtggtgtgtgtggac
cagtacagaccttgccttcacaacagactgcactcccacccgattctgtctgctatagct
aaaatcatgaaggagtgctggttccagagtccctcagctcgcctcactgccctgcgtgtc
cgtaagaccctggcaaagctggaccaagaccaagactgcagcacagacaaactcaaattg
gatgtctag

DBGET integrated database retrieval system