KEGG   Pangasianodon hypophthalmus (striped catfish): 113531135Help
Entry
113531135         CDS       T05759                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113531135 (thnsl2)
Enzymes [BR:phyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     113531135 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF4715
Motif
Other DBs
NCBI-GeneID: 113531135
NCBI-ProteinID: XP_026777461
Position
Unknown
AA seq 484 aa AA seqDB search
MQYCSTRGGVHGWDFRDVLFSAYAPDGGMFMPETIPSISPATLRSWCSLSYQQLVCEVCS
LFIPEQLIPKHDLEGLISSALSKFSVPDAVKMVRLKGSLSILELFHGKTLAFKDLAMTCT
TRFLEYFLRKDNRRAIILVGTSGDTGGSAISSVCELSAVDIVVVFPRGRITQVQERQMTT
HTEDNVHVFAADGSSDEIEVPLRKLFADQDLVNRYGLMSLNSVNWSRILVQLAHFIYAYL
QLSGVRDTDGDRLPALEVVVPTGGAGNITAGCIVKHMGVPLHLVAMVNSNDVVHRAVQSG
DFSMADSVKQTLAPAIDIQDPYNMERVFWLLSGKDGALVKKMMEQFQDTHTLSLPETLHK
KLCSVMCSGSVSDEGIMEAIKRCWEENQYLVCPHTAVGVWHHYHCPVRNGENRCCIATAS
PAKFPEVVQKAGLTIDLPEVVRQLETKETRYKHLERSENWETALRERIEAIGSARQQEAL
FYTV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcagtactgcagcacacgtggaggggttcacggctgggacttccgggatgttctcttc
tcagcctatgctccagacgggggcatgttcatgcctgagacaattccctcaatctcccct
gccactctccgatcctggtgttctctgtcctaccagcagcttgtgtgtgaagtgtgttcg
ctcttcatccctgagcaactcatcccgaaacatgacttggaaggcctcatatctagtgct
ctgtccaagttctccgtgccagatgcagtgaagatggtgcgactgaagggctctctgtcc
atcttggaactgttccatggaaagacgttggcgtttaaagatctagccatgacctgcacc
acacgctttctggagtacttcctgcgcaaggacaacagacgcgccatcatcctcgtgggg
acatctggggacactggaggctcagccatcagcagtgtgtgtgagcttagtgcggtggac
atagtagtggttttcccccgtggacgaatcactcaggtgcaggagagacagatgaccact
cacacagaggacaatgtccatgtttttgcagcggatggaagttcggatgaaatcgaggtg
cctttgaggaagctgtttgctgatcaggacttggtgaatcgctatggtctgatgagcctg
aactcagtgaactggtcacgcattctggtgcagctcgctcattttatatacgcctacctg
cagctgagtggagttcgggatacagacggagacagactacccgctctggaggttgtggtg
cctacaggaggggcaggaaatataacagctggatgcatcgtaaagcacatgggggttcct
ctgcacctcgtggccatggtgaactctaatgacgtggtgcaccgtgcagttcagagtgga
gatttctccatggctgacagtgtcaagcagactctggctccagccattgatattcaggat
ccttataacatggagcgtgtgttctggctgttatctggaaaagatggtgctttagtaaag
aagatgatggagcagtttcaggacactcacacactctctctacctgaaacactccacaaa
aagttgtgttcagtcatgtgttcaggttctgtgtctgatgaggggataatggaggccata
aagaggtgttgggaggaaaatcagtatttggtgtgtcctcatacagctgtgggagtctgg
catcactaccactgtcctgtccgcaatggggagaataggtgttgcattgcgacagcttct
ccagccaagtttcccgaagtggtacagaaagcaggcctgaccatcgacctccctgaagtg
gtgaggcagctggaaacgaaggagacacgctataaacatctggagcgaagcgagaactgg
gaaacagcactaagagagcgtatcgaggctatcggctctgcacgacaacaggaagcactg
ttttatacagtatag

DBGET integrated database retrieval system