KEGG   Pangasianodon hypophthalmus (striped catfish): 113531491Help
Entry
113531491         CDS       T05759                                 

Gene name
npr2
Definition
(RefSeq) atrial natriuretic peptide receptor 2 isoform X1
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp01100  Metabolic pathways
phyp04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113531491 (npr2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113531491 (npr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113531491 (npr2)
Enzymes [BR:phyp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113531491 (npr2)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   113531491 (npr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 113531491
NCBI-ProteinID: XP_026778063
Position
Unknown
AA seq 1048 aa AA seqDB search
MGHKTHLVHCFLVIFLCCVLTWCRTDAGNNITVAVLLPDNIKYPWASPRVLPAIRMAREN
ILKSGLLGARGINLLNFSVEDSTGSCSENKAQIIAVDTKLYHKPDAFIGPGCVYSVASVG
RFASHWKLPLITAGGLAFGFDNTDEFRTIFRTGPTTTKLGDFVNALHAQFNWTRRAVMIF
HDLKQDDRPHFFLSEGIFLNLRDENITVEAFPYEEEHSNYKDIVTSVKENGRIVYICGPL
QTFFKIMHSFEEEVKNPEDYAIFYLDAFGESLSDDMHRPWQSSDVQWKDPVKLFQSVFVI
TYREPDNPEYTAFRTELHKRTTQDFNIQLEPSLMDFIAGCFHDGFMLYVKALNEALADGV
SQNDGVGVIARMQNRRIWGVTGLISTDKTNARFTDFSLWAMTNLETGQYGVVGHYNGTNK
EIMWSATERIHWPKGCPPLDEPRCLVSCEDQIPVLGIVAVGSGLALIIFGMSSFLIYRKL
KLEKELAGMLWRIRWEDLQFESPNKYHRRAGSRLTLSQRGSSYGSLITAHGKHQLFAKTG
YFKGNLVAIKHVNKRIELTRQVLFELKHVRQEMRDVQFNHLTRFIGACIDPPNVCIVTEY
CPRGSLQDILENESINLDWMFRFSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVL
KITDYGLASFRASNENEDSHELYARKLWTAPELLIYDRPPPQGTQKGDVYSFGIILQEIA
LRNGPFYVEGMDLSPKEIIQKVRNGQKPYFRPTTDNSRHCEELTTLMENCWAEDPTERPD
FSHIKIFITKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRRAENLLYQIL
PHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIID
NFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKSFKIRHRPNDQLWLRI
GIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHVSSATKEVLDEFGYFDLQ
LRGDIEIKGKGKMRTYWLLGEKTDVYVI
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgggacataaaacgcatctcgtgcattgtttcctggtcatatttctttgctgcgtcttg
acttggtgcagaacggatgcagggaataacatcacggtggccgtgttgctcccggacaac
attaaatacccgtgggcatcgccgcgcgtgctgcctgcgatacgcatggcgcgagagaac
atcctgaaaagcggacttctcggagcgcgcgggataaacctgctgaacttcagcgtggaa
gactccacgggctcgtgctccgaaaacaaagcgcagatcatcgccgtggacacgaaactc
taccacaaaccggacgccttcatcggcccgggctgcgtgtactccgtggcctcggtgggc
aggttcgcgtcccactggaagctgccgctcatcaccgccggaggactcgccttcggcttc
gataacacagacgagttcaggactatcttccgcaccggacccaccaccaccaagctggga
gacttcgtcaacgcgctgcacgcgcagttcaactggacgcggcgtgcggtgatgatcttc
cacgacttaaagcaggacgatcggccgcacttcttcctctctgaaggcattttcctcaac
ctgcgagacgaaaacatcaccgtggaagcttttccctacgaggaagaacattccaattat
aaagacatcgtcacttctgtcaaggagaacggaagaatcgtgtacatctgcggacctctt
cagacgttctttaaaatcatgcacagctttgaggaggaggtgaagaacccagaagactac
gccatcttctacctagatgcgtttggtgagagcctgagtgatgatatgcaccggccgtgg
cagagctcagatgttcagtggaaggatccagtcaagctcttccagtctgtattcgttata
acgtaccgggagccagacaacccagagtacacagctttccgtaccgaactccacaagaga
acaacgcaggactttaacattcagttggaaccgtctttgatggatttcattgccgggtgt
ttccatgacggatttatgctctacgtgaaggccctgaatgaggctttagcagacggagtg
tcgcagaacgatggtgtcggtgtcattgcaaggatgcagaaccgcaggatctggggagtg
acaggtctcatcagtacagataaaaccaacgccaggttcacagacttcagcctctgggcc
atgaccaacctggaaactggacagtatggtgttgttggtcactataatggaaccaataag
gaaattatgtggtcggctacagagaggattcactggccaaagggctgcccaccactcgat
gagcctcgatgtctggtctcgtgtgaagaccaaattcctgtcctaggaattgttgctgtg
ggctccggtcttgccctcatcatttttggaatgtcaagctttctcatttacaggaagttg
aagttggagaaggagctggcaggaatgctgtggaggattcgatgggaggatctgcagttt
gaaagccccaacaaataccacaggcgcgctggcagccgcctcactctttcccagaggggt
tccagctacggttccttgatcacagcgcacggaaaacatcagctgtttgcaaaaacaggc
tattttaagggaaacctggtggcaatcaagcacgtgaacaagaggatcgagttgacaaga
caagtgctgtttgaactgaagcatgtaaggcaagagatgagggacgtccagttcaaccat
ctcaccaggtttattggtgcctgtattgatcctccaaacgtctgcattgtgactgaatat
tgcccccggggtagcctacaggacattttggaaaacgagagcatcaatctggactggatg
ttccggttctcactgatcaatgacattgtcaagggaatgaactatctgcacaacagctac
attggttcccatggaaatttgaaatcatcgaactgcgtggtggacagtcgctttgtactg
aaaattacagattatggtctggcaagctttcgggcgtccaatgagaatgaagactcgcat
gaactttatgcaagaaaactatggacagctccagagttactgatatatgatagacctcca
ccacagggaacccagaaaggagatgtgtacagttttggaatcatcctgcaggagatagcc
ttgagaaatgggccgttctatgtggaaggcatggatctgagcccgaaagagataatccag
aaagtgcggaatggccagaagccctacttccgtccaacgacggataactcgcgtcactgc
gaggagctgaccaccctgatggagaactgctgggcagaggatcccaccgagcgcccagac
ttcagccacatcaagatcttcatcaccaaactcaacaaagaagggagcaccagcatcctc
aataacctgctgtcccgaatggagcagtacgccaacaacctggagaaccttgtggaggag
cgaacgcaggcctacttggaggagaagaggagagccgaaaatctgctttaccaaatcttg
ccacattcagtagcagagcagctgaagagaggagagacagtgcaggcagaggcttttgac
agcgtcaccatctatttcagtgacatagtgggcttcacttcaatgtctgctgaaagcaca
ccgttacaggttgtaacattgctgaatgacttatacacatgtttcgatgccatcattgat
aattttgatgtttataaggtggagaccatcggtgatgcctatatggtggtgtctggtctc
cctgtacgtaacggcaaactccatgctcgtgagatcgctggaatgtcattagctttactg
gagcaggtcaaaagctttaaaatcagacacagaccgaatgaccagctgtggctacgcatc
ggaatccacacggggcctgtctgtgcaggtgtagtaggactcaaaatgcccaggtactgt
ttatttggagacactgtcaacacggcatcaaggatggagtccaccggggaagccctgcgg
atacacgtgtcttccgccaccaaagaggtgcttgacgagtttggctacttcgacctccag
ctacgaggggatatagaaataaagggcaaaggcaaaatgagaacgtattggcttctaggg
gagaagacagatgtctatgttatctga

DBGET integrated database retrieval system