KEGG   Pangasianodon hypophthalmus (striped catfish): 113531572Help
Entry
113531572         CDS       T05759                                 

Gene name
mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00450  Selenocompound metabolism
phyp00970  Aminoacyl-tRNA biosynthesis
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    113531572 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113531572 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phyp01007]
    113531572 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phyp03016]
    113531572 (mars)
Enzymes [BR:phyp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     113531572 (mars)
Amino acid related enzymes [BR:phyp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   113531572 (mars)
Transfer RNA biogenesis [BR:phyp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    113531572 (mars)
 Prokaryotic type
   Other AARSs
    113531572 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 tRNA-synt_1 Anticodon_1 GST_C_3 DUF4404 GST_C_2
Motif
Other DBs
NCBI-GeneID: 113531572
NCBI-ProteinID: XP_026778183
Position
Unknown
AA seq 846 aa AA seqDB search
MKLFVNEGNPQCVKVLAALEHTAVQCDVQLLSHEERVVSFLSRPVLPAVLLPSGQQLFSA
NAICQYLFEVGGKEITDASRQLLEWEATELQPVLLQALHVAVLQGKSSEAGTLLKKPLSW
LEQCLSGKSTQFLAAETVEVADIVLWAALYPVLSVSALEAGELRSVQGWFERVGQLPACT
TAVQKILPGKDLKALKNFLQKQPAPHTQQKENLPSELEGVEHVMTAEEIEVAAQAWTKGL
AECHDAIERKNPVLPEEGMRNVLVTSALPYVNNVPHLGNIIGCVLSADVFSRYGRLRGWN
LLYVCGTDEYGTATENKALEEGLTPQEICDKYYAVHTAIYKWFQIDFDYFGRTTTQQQTE
IAQNIFFRLHERGFLHEDTVEQLCCENCQRFLADRFVEGVCPYCKYPEARGDQCDKCGRL
INAVELKDPQCKVCGQTPVIRTSKHLFLDLPQLEGELEKWLEQSLNTGDWTANAKQITRS
WIRDGLKPRCITRDLKWGTPVPLPEYSGKVFYVWFDAPIGYLSITANYTSEWEKWWKNPQ
QVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLIATEYLNYEDTKFSKSRGVGVFG
DMAKDTGIPSDVWRFYLTYVRPEGQDSSFSWADLALKNNSELLNNLGNFINRAGMFVNKF
FNGCVPEIVLQDEDKRLIAQVSWELKQYIQLLDKVRIRDALKCILNISRHGNQYIQSNEP
WKKIKGGDEDRKRAGTVTGVSVNVACLLSAMLEPYMPTVSRTIRTQLQASDNCASAMLGA
EGCFLRSLPTGHQIGTVSPLFQKLESEQIETLRKKFGGQQGRSEETSTTETKPPNAAEPI
ASQGKK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttgtgaatgaaggcaatccgcagtgtgtgaaagtgctggcggcgctcgag
cacaccgcagtgcaatgtgacgtgcagctgctcagccatgaggaacgggtggtgtccttc
ctgagtcgcccagtcctgcctgctgtgctgttgcccagcggccagcaacttttcagtgct
aatgccatctgccagtatctgtttgaggttggtgggaaagaaatcactgatgctagcagg
cagttactggaatgggaagcaaccgaattgcagcctgtgctgcttcaggccctccatgtg
gcagtgctgcaggggaagagcagcgaggctggcacactgctgaaaaaacctctgagctgg
ctggagcagtgtctgagtggaaaaagcacacagttcctagctgcagagacagtcgaagtg
gcagacattgtcttatgggcagcactgtaccccgttctgtctgtctcggctttggaagct
ggtgagctgcgttctgttcaaggctggtttgagcgtgtaggtcagctcccagcatgcacc
acagcagtgcaaaagattctgccaggcaaagatcttaaagctctgaagaatttccttcaa
aagcaaccagctccacacacacagcaaaaggaaaacctgcccagtgagctggaaggcgtg
gagcatgtgatgactgcagaggaaattgaggtagctgctcaggcttggactaaaggactg
gcagagtgtcatgatgccatagaaaggaaaaaccctgttttacctgaggaagggatgcgt
aatgtgctggtcacaagtgcactgccgtatgtcaacaacgtgcctcacctaggcaacatc
atcggctgtgtgctgagcgctgatgtattctccagatatggccgtttgcgtggctggaac
ttgctttatgtgtgcgggacagacgagtacggcactgcaacagagaacaaggctcttgag
gagggtctaacgccccaggagatatgtgacaaatactatgctgtccacactgccatctac
aagtggttccagatcgactttgactatttcggccgaaccaccactcaacaacagacagaa
attgcacagaacatattctttcgtttacatgagaggggatttttacacgaggacacagtg
gagcagctgtgctgtgagaactgtcagcgcttcctagctgaccgctttgtagagggtgtg
tgtccttattgcaaatatcctgaagccagaggggaccaatgtgataagtgtggccgactc
attaacgctgtggagctcaaggatcctcagtgtaaggtgtgtggacagactcctgtgatt
cgcacctctaagcacttgtttcttgacctgccccagctggaaggcgagttggagaagtgg
ctggagcagtctttgaatacaggtgattggaccgctaacgctaagcaaatcacccgctca
tggataagagatggtctgaagccacgctgcatcacacgagatctgaagtgggggacacct
gtaccactcccagaatatagtggaaaggtgttttatgtctggttcgacgcgcccattggc
tacctctcaataactgccaattacaccagtgaatgggagaaatggtggaagaacccacaa
caggtggagctgtacaacttcatggcaaaagacaatgtaccattccacagtgtagttttc
ccctgctctctgctcggggcacaggacaactacacactcgtcaaccacctcatcgctaca
gaatatttgaactatgaggacacaaagttctcaaagagccgtggtgtgggagtgtttgga
gacatggctaaagacacaggcattccatcggacgtttggcgtttctatcttacctacgtg
agacctgagggccaggactcctccttctcttgggccgacctggctctgaagaacaactcc
gaactgctcaataaccttggcaattttatcaacagggcaggcatgtttgtgaataagttc
tttaatggctgtgtgccggagattgttctgcaggatgaagacaagcgtctcattgctcag
gtgtcctgggagctcaagcagtacatccagttgctggacaaagtcaggattcgcgatgcc
ttgaagtgcattctcaatatctctcgtcatggcaaccagtatattcagagtaatgaaccc
tggaagaagatcaaaggaggagatgaggacaggaaacgtgcaggcacagtaactggcgtg
tcggtgaatgtggcgtgtctcctgtcggccatgttggagccgtacatgcccacagtcagt
cggaccattcgtacccagctgcaagcttcagataattgtgccagtgccatgctgggtgct
gagggatgtttcctccgcagcctcccaaccggccaccaaatcggcacggtcagtcctttg
ttccagaagctggagtctgagcaaattgagacactaaggaagaaatttggaggacagcag
ggtcgcagtgaggagacgagcacaacggagaccaagcctcccaatgccgcagaacctatt
gctagtcaaggaaagaagtga

DBGET integrated database retrieval system