KEGG   Pangasianodon hypophthalmus (striped catfish): 113532157Help
Entry
113532157         CDS       T05759                                 

Gene name
mgat2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00510  N-Glycan biosynthesis
phyp01100  Metabolic pathways
Module
phyp_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    113532157 (mgat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phyp01003]
    113532157 (mgat2)
Enzymes [BR:phyp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     113532157 (mgat2)
Glycosyltransferases [BR:phyp01003]
 Glycan extension
  N-Glycan
   113532157 (mgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 FeoB_associated
Motif
Other DBs
NCBI-GeneID: 113532157
NCBI-ProteinID: XP_026779157
Position
Unknown
AA seq 446 aa AA seqDB search
MRFRIYKRKVVILTLVVVICGFAVWSSGKQKRGSPVFPKEVEAVKKSSISSLAQVTASVT
RKPVNDTLPEKQVIPKPLTDNTTLVYRGIVFQINFDQTLRNEEKFKSIRQKDDLVVVVQV
HNRPEYLRLLVESLRKAKGIENVLLIFSHDFWSPEINNIISSIDFCLVLQIFFPFSIQLY
PQEFPGNDPRDCPRDISKKDALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWDR
VRVLKDHKGLVLLIEEDHFLAPDFYHLLKLMTSLKKEQCADCDIISLGSYGHIGYASKAN
RVEVKAWKSTEHNMGMAMDRETYQKLIQCTEAFCTYDDYNWDWSLQHLTVTCLPTFWKVM
VSEAPRIFHAGDCGMHHKKTTCMPSNQKRKIENILQSSTNQLFPKNLLITKRLPASGAGG
VAPHVKNGGWGDIRDHELCKSYLRLQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagattccgaatctacaagaggaaagtggtgatcctgactctggtggtcgtaatctgc
ggatttgccgtttggagcagtgggaaacagaaaagaggaagtcctgtttttccaaaggaa
gtggaggctgttaagaagagcagcattagtagtctggcacaggtcacagcatcagtaacc
cggaaaccagtcaatgacacgcttccagaaaaacaagttatacccaagcctttgacagat
aataccactctggtgtaccgggggattgtgttccaaatcaactttgaccagaccttgagg
aatgaagagaagttcaagtcgatacgccagaaggatgacctagtagtagtagtgcaggtt
cacaatcgaccagaatacctgaggttgcttgtagaaagcttgagaaaagcaaaaggaatt
gaaaatgtcctacttatattcagccatgatttctggtccccagagattaacaacataatt
tcgtccattgacttctgccttgtccttcagatattctttccttttagcatccagctgtat
cctcaagagtttccagggaatgaccccagagactgccccagagacatttccaagaaagac
gccttaaaactcggctgcataaatgcagagtaccctgattcttttggccattaccgcgag
gccaaattttcccaaaccaaacaccactggtggtggaaattacatttcgtgtgggacagg
gtccgtgtgctgaaggatcacaaaggattggtgcttcttatcgaggaggaccacttctta
gccccagatttctaccatcttctcaaactgatgacatctctaaagaaggagcagtgtgct
gactgtgacattatttctctagggagctacgggcacatcggctatgccagcaaagccaac
cgagtggaggtgaaggcctggaaatccacagagcataacatgggcatggccatggacagg
gagacgtaccaaaaactcatccagtgcacagaagcattctgcacctacgacgactacaac
tgggactggtcccttcagcacctaactgtgacctgtctgcccactttctggaaggtcatg
gtgagtgaagctccccgtatctttcatgctggggattgtggcatgcaccataagaagacc
acttgtatgcccagtaatcagaagagaaagatagaaaacatacttcagagcagcacaaac
cagctgttcccaaaaaatttgctcatcacaaagagactgcctgcatctggggctggtgga
gtagcccctcatgtcaaaaatggaggctggggtgatatcagggaccatgaactctgcaag
agctatcttcggttacagtga

DBGET integrated database retrieval system