KEGG   Pangasianodon hypophthalmus (striped catfish): 113532619
Entry
113532619         CDS       T05759                                 

Definition
(RefSeq) uncharacterized protein LOC113532619 isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113532619
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    113532619
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3
Other DBs
NCBI-GeneID: 113532619
NCBI-ProteinID: XP_026779863
Position
Unknown
AA seq 674 aa
MILLISGSWLSKSCTPFPWPEREMIPPGDCMYAGRKRRKPIPKHRKPAPASEKSNPSKRH
RDRLNAELDRLASLLPFPHEIISKLDKLSVLRLSVSYLRIKSFFHASQEKQMMKHLSPPS
INDIRGELGTSESELLLESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNFFDYI
HIDDRQEFRQQLHWSMNPSVTSDQDLATGNGEDFVVSSLFHSQKAPGVPPEFSSFLNRCF
ISRVRCLRDSTSGFLTMQFQGHLKFLYGQKKKTASGTSLPPQLALFCVAMPLLLSSITEM
KTKNTIIRGKHKITGNNMFIDHSDREEHSRRHSVMNEGRDTLSLNSSTPVATLLHHTPWA
PFSKENVKFKNEDYYSKEEPLNVCKDSLGGQKAPDLDTTLPPRGSYGPFCTGHGVNLLFG
GRVSKHGHYGKPNKISPVYYNSTAELYIPKIYGSLPPQEVVEGNYVDIKKSENACFEGQR
QVCDAHLIAELPIKVEQDSDAENERDFYDQAWTDREHNLSSYDGLQMKAEDSYYEQYMPC
QKSTGSNGQQYSSQYLNAFGTTAQPLKCVLDKDPEYLRHQRLGHVHPLCSSQSANCMDSY
NAGTMEHKGFIHQDYKLGYQFKGQGLLHSIKREPMDSPPWHENEYEQIGGQWNMMPNCIM
NLGQPKANPYIFMQ
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgattcttctcatatctgggagctggctgagtaagtcttgcacaccttttccctggccc
gagcgcgagatgatcccaccaggagactgcatgtatgctggtcggaaacggaggaagccc
ataccaaagcacagaaagcctgcacctgcgagcgagaagtccaacccatcaaaacggcac
cgagaccggctgaatgcagagctagatcggctggccagtctgctacctttcccacatgag
atcatctccaaactggacaagctttctgttttgcgtctcagtgtcagttaccttcgtatc
aagagcttcttccatgccagtcaagagaagcagatgatgaagcacctcagccctccgtcc
attaatgacatcaggggggaacttggtacctctgagagtgagctgctgctggagtccctt
acaggctttgctcttgttgtgagcagtgatggaatggtcttctatgcttcctctactata
gtggactatctgggcttccatcaaactgatgtgatgcaccaaaacttctttgactacatc
cacatagatgataggcaggagttcaggcaacagctccactggtccatgaatccctcagta
acctctgatcaagatttagccacaggaaatggggaagatttcgtggttagcagtttattc
cactcccagaaggcacctggtgttcctccagagttttcttctttccttaaccggtgtttc
atctcgagagtgcgctgtctgcgggacagcacctcaggatttcttactatgcaattccag
gggcatctaaagttcttgtatggacagaagaagaagacggcatctggcacctccttaccc
ccacagctggctctgttctgtgtggccatgcctctgctcttgtcctccatcacagagatg
aagacgaaaaacacaataataaggggcaagcacaaaatcacaggcaataacatgttcata
gatcatagtgacagagaagagcactcaagaaggcactcagtgatgaacgaaggcagagac
acactctctctgaattcttccactccggtagccaccttactccaccatacaccctgggca
ccattttccaaagaaaatgtcaaattcaagaacgaggactactatagtaaggaagagcct
ctcaacgtctgcaaggactctttaggtggccagaaagcccctgacttggacacaacattg
cctcccagaggctcttatgggcccttctgcactggtcatggagtcaacttgttgtttggt
ggtagagtaagcaagcatggtcactatgggaagcccaacaaaatatccccagtgtattac
aacagcacggcagagctttatattccaaaaatctatgggagtcttccaccccaagaagtg
gtggaaggtaattatgtggacatcaaaaaaagtgaaaatgcctgttttgagggccaaaga
caagtctgtgatgcacatctgatagctgagttaccaatcaaggtagagcaagactctgat
gctgaaaacgaacgtgacttttatgaccaggcttggacagaccgagagcataatctcagc
tcttatgatggcctacaaatgaaagcagaagatagttactatgaacagtatatgccttgc
caaaaaagcacagggagtaatggacaacagtacagtagccagtacttaaatgcctttgga
acaactgcacaacctctaaagtgtgtccttgataaagatccagaatatctccgtcaccag
aggctgggacacgtacacccactctgcagtagccaaagtgctaactgtatggacagctac
aatgctgggactatggagcacaagggcttcatacatcaggattacaaacttggctatcag
ttcaaaggacaaggactgcttcattccatcaagcgtgagcctatggattctccaccctgg
catgaaaatgaatatgaacagataggtgggcaatggaatatgatgccaaattgtataatg
aatctagggcagcccaaagctaatccatatatctttatgcaataa

DBGET integrated database retrieval system