KEGG   Pangasianodon hypophthalmus (striped catfish): 113533593
Entry
113533593         CDS       T05759                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phyp01002]
    113533593 (adamts13)
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     113533593 (adamts13)
Peptidases and inhibitors [BR:phyp01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   113533593 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin TSP1_CCN Reprolysin_2 Peptidase_M10 CUB Peptidase_M66
Other DBs
NCBI-GeneID: 113533593
NCBI-ProteinID: XP_026781627
Position
Unknown
AA seq 1544 aa
MAALVSLFLASVLVDTALLASQTSLEKDFLQSLAPEDIFHYFDSNSTTLVPEFELVWVSC
FRDESSGRHCSFQAQGKDFKLRRRNEPSLSCPSNLEIAINTTLSVIKRRDNTCCEQLDIL
QPEDARSFLSVCDGKLQGLLLLQSGKLHVHPLSHKHSDHLRNAVATPPGVPHLLLPRPSP
VRTRLQQSQSHRRLQRSLLGAEVTHLELLVVVSPDVHEVHKQDTERYILTNLNIASELLR
DVTLGANIRVHLIRMIILTEPEPDIQISDDITSSLRSVCEWGHKVNPSSETDPLHADLLL
YITRFDLVLPSGNKQVRGVTQLGGVCSSQWNCVITEDTGFDLGITIAHEIGHSFGINHDG
VGNTCSSGGFIMASDGGYNSVDLTWSQCSRNQLLNFYSAGKAECVKDVPVLGGSLQEWKP
GLYYGVDDQCRIAFGSTATACSFTSSDMATCRVLSCHIIPGDRSTCTRLLVPLLDGTECG
LNQWCLKGRCVSASKLSSSLLVHGSWSSWSEYSSCSRTCGGGISYRKRECNNPRPAFGGR
NCEGEEMEAELCNRQPCESNQLEFMAQQCSDTDHQPLLLSAYSTTAYSWIPAVGFISGDA
QCKLMCRSREQDFMVSRGAQFIDGTRCELDGPVSAGSVTACLNGKCKVFGCDGVLHSGKV
EDVCGVCGGKGNTCHLITGSYTGGEAKEYVTFLILPVNASQVHINNWNPVFTHMAMLVND
EYIVAGDGDIALNTTHPSPLEENHMIYNLYLTPDLLPHTEELILSGPITDKIYIQVYRKY
GREYGDITSPNITYQYYMPDVEPVEKIIKGRWSTVISSCSVTCGSGIQRVSQECVDMNTQ
EHLEEQLCSSVTPKPTTLQPCHLPDCPPSWVLGEFGPCSAPCGVGERLRSVACMQKRGME
TVALPDSSCSQMNKPAATETCNTQLCSARWQISGPGECSAVCGPGEAHRSVSCIRSHRGA
DLEVDESLCLHPKPSEHVPCVVDVCPIGWETHGKYQQDHTGSLSVILRSKIIPVYVWSPV
IGHCSKTCGNGTQQIWFSCVDHNSRLDVPEFLCDRFSKPEPYTKLCVQSPCPAMWRYIQG
VCSVSCGGGVARRVLYCSQQAAGGDGGMEVVLAESACLPASRPLKVVPCNTEPCPARWQV
GEQGPCSVSCDLGVALRRVSCVQFDGKLQREVEDEHCEEGKKPPLTVPCFTQACSFHWGV
QEWSECSVSCGYGIQSRTVSCLGPSSPLPITPILCVHLPKPITIQACYSANCSTLGPSTA
PTQKPEAWSKTSAWKFLDEEKRTTYAPAGDTEKFSEVVPTVPALRSTTTLSTQPPQSSLC
GQLFLQDTGIIDLRNVSERRCFISIGRPLDEVIQIRIESSSLNCRHKENLALYERKSLRQ
ICEKMAGKTLTSRSNVLLVRQSHLTPGSGVLLSYQSKKNMKKSHHEDCDVQLFSPSGLIE
NPVRSSSSSSSSMQSCRVFIDAPPALRIQIRALSVFNTTSSDSAYVLIRDVDAVKTAVFK
GKQLFHWSSTGSRAEVEFHGEYQQMKGAFRAQYSYIKPEEAKLI
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggctgcactggtgtcgctctttctggcgtcagtcctggtggatacggctctgttagcg
tctcagacttcactggagaaggattttttacagtcactggcccctgaggacatattccat
tattttgactctaattcaacaacattagtgcctgaatttgagcttgtgtgggtaagttgc
ttcagggatgagagcagtggaagacactgctcgtttcaagcccaggggaaagacttcaaa
ctgaggcggagaaacgagccgtccttgtcctgtccctccaacctggagatcgccatcaat
accacactcagtgtaataaagaggagggataatacgtgttgtgagcaacttgacatattg
cagccagaagatgctagatcgtttctctcagtttgtgatggaaaacttcaaggcctgctt
ctcttgcagtcaggaaagctacacgttcatccactgtctcacaaacattcagatcacctg
agaaatgctgtggccacacctccaggtgtaccacacctgctcttgccccgcccatcacct
gtaaggacacgccttcagcagtcacagagtcatcgtaggcttcagaggtcacttctaggg
gcagaggtcactcatttagagctgctggtggtagtcagtcccgatgtccatgaggttcac
aagcaggacacagagagatacatcctcaccaacctgaacattgcatctgagctgttacga
gatgtcactctaggggcaaatataagagtccacttgatccgtatgatcattctcactgag
ccagagccagacattcagatctctgatgacatcacttcctctctgaggagtgtgtgtgag
tggggtcataaagtcaacccttcctctgagactgaccccctgcatgcagacctgctcctg
tacatcaccaggtttgatttagtattgcccagtgggaataaacaggtgagaggcgtgacc
cagctgggtggagtctgttctagccagtggaattgtgtaattacagaagatacaggcttc
gaccttggcatcactattgcacatgagattggacacagttttggaataaaccatgatggc
gtaggcaacacatgcagcagtggtgggtttataatggcgtctgatggcggttacaacagt
gtggatctcacctggtctcaatgcagcagaaaccagctccttaacttctacagtgcaggc
aaggcagagtgtgtgaaggatgtaccggtgctgggaggatcgctgcaggagtggaaaccc
ggactgtattatggtgtggatgatcagtgtcgcatcgcattcgggagcacagccactgcc
tgctccttcactagcagtgacatggctacctgtcgagttctgtcctgccatatcatccct
ggcgatcgcagcacctgcacccgacttcttgtgccgctgttggacggcactgaatgtgga
ctaaatcagtggtgtttaaagggccgttgtgtatctgcgtccaaactgagctcctctctg
ctggttcatggctcctggtcatcctggtctgaatactcctcctgttcacgcacctgtgga
ggagggatctcataccgaaagagagagtgcaacaatcccaggccagcatttggaggaaga
aactgtgagggagaagagatggaggctgaactttgtaatcgacagccatgtgaaagtaac
cagcttgagttcatggcccagcagtgctcagatacagaccatcaacccctcctgctttct
gcatattcaaccacagcctactcatggattcctgcagttggtttcatttcaggtgatgct
cagtgtaagctgatgtgtcgctctcgtgagcaggacttcatggtgagtcgtggggctcag
tttatcgacgggacgaggtgtgaacttgatggccctgtcagtgctggctctgttactgcc
tgccttaacgggaagtgcaaggtgtttggctgtgatggagtgttgcactctgggaaagtg
gaggacgtttgcggggtgtgtggaggaaaaggcaacacctgccatcttattactggctct
tacacaggtggagaggccaaagagtatgtcactttcctcattctgccagtgaacgcctct
caggtccacattaataactggaatccagttttcacacatatggccatgctggtgaatgat
gaatatatagtagctggagatggggatatagcattaaacacaacccacccttcacctttg
gaggagaaccacatgatctataacctctacctcacccctgacctcctacctcacacagag
gagctcattctgtccggaccaatcacagacaagatctacatacaggtgtatcgaaaatat
ggaagggaatacggagacatcacgagtccaaacatcacctatcagtactacatgccagat
gttgaaccagtggagaagataataaagggtcgatggtccactgtcatttcatcttgttct
gtaacctgtggctcagggattcagagggttagtcaggagtgtgttgacatgaacactcag
gaacacctagaagagcaactctgcagctcagttactcccaaaccaaccaccctgcagccg
tgtcacctacctgactgccctcccagttgggtgctgggtgaatttggtccttgcagcgcc
ccttgtggagttggagagcggctgcgctctgtggcctgtatgcagaaacggggtatggaa
acagtggcattgccagattcttcatgctctcagatgaacaaacctgcagcaacagaaacc
tgcaacactcagctgtgctctgccagatggcaaatctcagggcccggtgagtgttcagct
gtgtgtggtccaggtgaggctcacagatcagtgtcctgcatccgctcccaccgtggtgct
gacctggaggtagacgaaagcctctgtttacatcccaaaccttctgaacatgtcccgtgt
gtggtggatgtgtgccctattggctgggaaacacatgggaagtatcagcaggaccacaca
gggtcactttctgtaatactccggtccaaaataattccagtatatgtgtggagccctgtg
attggccactgctctaagacttgtggaaatggtactcagcagatatggttctcctgtgtg
gaccataattcacgactagatgtcccagagttcctttgtgatcgctttagtaagcctgaa
ccatatacaaagctgtgtgtccagtcaccctgccctgccatgtggcgctacatacagggg
gtgtgcagtgtgtcctgtggaggtggtgtggcaagaagggtgctgtactgctctcagcag
gctgcagggggagatggaggcatggaagtagtgctagcagagtcagcctgtctccctgcc
tccagacctctaaaagtggtgccatgtaacactgagccctgtccagcaaggtggcaagtg
ggtgaacagggtccatgttcagtgtcctgcgacctgggtgtggcattaaggagggtctca
tgtgtccagtttgatgggaaattgcagagagaagttgaggatgagcattgtgaagaaggc
aagaaacctcctctcacagtgccctgcttcacccaggcctgttccttccactggggtgta
caggagtggagtgagtgttcagtctcttgtggttatgggatccagtctcggactgtctca
tgccttgggccgtccagccctctacccatcactcccatcctctgcgtccaccttcccaaa
cccatcactatccaggcctgctacagtgccaactgctccaccctgggtccaagcactgct
cctacccagaaaccagaggcctggagcaagacgagtgcatggaaattcttggatgaggag
aagaggaccacatatgcacctgctggagacactgagaagttctcagaagttgtacctaca
gtaccagcgttgaggagcaccacaacattgtcgacacaacctccacagagcagtttgtgt
gggcagctatttcttcaggacacgggaatcattgacctaaggaatgtcagtgagagacgg
tgtttcatctctattggccgtcctctggatgaagttatccaaatcagaattgagtccagc
tctcttaactgtagacacaaagagaatcttgccctttatgagagaaagtctctgaggcaa
atctgtgaaaagatggctggaaagacgctgacttcacgctctaatgttctgttggtgcgt
caaagccatctcacccctggcagtggagtgctgctttcctatcagagtaagaagaacatg
aagaaaagccatcatgaagattgtgatgttcagctgttctctccatctggtttgattgag
aacccagttaggagttcatcatcctcatcctccagcatgcagtcttgtcgggtgttcatt
gatgccccgcctgcattaaggatacagatcagagcgctatctgtattcaatacaacctcc
tcagactctgcatatgtgctgatccgagatgtagacgctgtaaaaactgcagtatttaaa
ggcaaacagcttttccactggagttctacaggaagcagggcggaagtggaattccatggg
gaataccagcaaatgaagggagcatttagagcacagtattcttatattaaacctgaggag
gctaaactgatctag

DBGET integrated database retrieval system