KEGG   Pangasianodon hypophthalmus (striped catfish): 113534313Help
Entry
113534313         CDS       T05759                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00600  Sphingolipid metabolism
phyp01100  Metabolic pathways
phyp04020  Calcium signaling pathway
phyp04370  VEGF signaling pathway
phyp04371  Apelin signaling pathway
Module
phyp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    113534313
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    113534313
   04371 Apelin signaling pathway
    113534313
   04020 Calcium signaling pathway
    113534313
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     113534313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Atg29_N
Motif
Other DBs
NCBI-GeneID: 113534313
NCBI-ProteinID: XP_026782808
Position
Unknown
AA seq 543 aa AA seqDB search
MDGAEELRAEFTDAATGRLRFSVTLTDSCLSVRKIGGSPVWQHGHEHALELGLGDCVGCR
ACRSEDEADTAAYLSAYFYPARRSWTGAPAGRQRVEHRFRVLTGEDARANLEEAERWARA
VRHRASQRVQGLRDGVEFSRVCVSRSVMVLVNPQSGRGQAMSLYTGPVLSMLTEANISHT
LITTEHQNHARELVRNADLSQWSAIVILSGDGLLFEVINGLMEREDWDEAIRTPLGILPG
GSGNALAASVHHYTQAGPALGEDLLLSCCFLLCKGLVCPLDIVSVCLSSGPRLFSFLSLA
WGFVADVDIESEKFRNVGAMRFLVGTLLRLASLRTYQGRLAFLPAREDSKSSSISSSPAS
HPRSLFCPSVQCISHMQRQNSNQHECTSENTRHNSNGDDFLLSKNESKDGRLPDNRLSPI
GDPVPTDWTIEKEQDFVLVLATCHSHLAEELMVSPDAQPDDGHLHLLYITAGISRPALLR
LFLAMEKGTHLTCECPHLIYRRVRALRLEPITKPGVITVDGEQVEYGPIQAQVHKGCARI
ICG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacggagctgaggagctgcgcgcggagttcaccgacgccgcgaccgggagactcaga
ttctccgtgaccttaacggacagctgcctctcggtgcgcaagatcggcgggtcgcccgtg
tggcagcacggacacgagcacgcgctcgagctcggcctcggtgactgtgtgggatgccgc
gcgtgccggagtgaggacgaggcggacacggcggcgtatctctccgcttatttctacccg
gcgcggcgcagttggaccggagctcccgccggccgccaaagggtggagcaccgattccgg
gtcctcaccggggaggacgctcgagccaacctggaggaggcggagaggtgggcgcgcgct
gtcagacaccgcgcatcacagcgcgtgcagggtctcagagacggtgttgagttcagtcga
gtgtgtgtcagccggagtgtgatggtgttggtgaatcctcagagtggacgaggccaggcg
atgtctctctacactggccctgtactgagcatgctcactgaggcaaacatctctcacaca
ctcatcaccacagagcatcagaaccatgcacgtgagttggtaagaaatgctgacctgtca
cagtggagcgccattgtcatcctctcaggggacggtcttctgtttgaggtgatcaatggt
ttgatggagagggaggactgggatgaagcgatccgcactccacttggcattctccctgga
ggatctggcaacgcactggcagcatcagtgcaccattacacacaagctggccctgcactg
ggtgaagacttgctgctaagctgttgtttcctgctctgtaaaggtctggtgtgtcctctg
gacatcgtctctgtgtgtctctcctccgggccccgtcttttttctttcctgtcgcttgcc
tggggcttcgtggccgacgtggacattgagagcgaaaagtttcgcaatgtcggtgccatg
cgcttcctcgtgggcactcttctgcgcctggcatctttacgcacctaccagggcaggctg
gcattcctgcccgcaagagaggactccaaatcgtcatcgatttcctcttctcctgcttca
catcctcgttcccttttttgtccctctgttcagtgtatatcacacatgcagcggcagaac
agcaatcagcatgaatgcacaagtgaaaatacacgccataactctaatggtgatgatttc
ttactctccaaaaatgagtcaaaggatggcagactacctgacaaccgcttgagccctatt
ggagatcccgtgccaacagattggaccatagaaaaagagcaagactttgttctggttctg
gcgacctgccactctcacctggcagaggagctgatggtgtcaccggatgcacaacctgac
gatgggcaccttcacctgctctatataacagcaggaatatcacgaccagccttgcttcga
ctcttcctggccatggagaaggggacgcacctcacatgcgagtgcccacatctgatttac
cggcgtgtccgagcactgaggcttgagccaatcacgaagcctggagtcattactgtggat
ggggagcaggtggagtacgggccaattcaagctcaagtgcacaagggatgtgccaggatc
atatgtggatga

DBGET integrated database retrieval system