KEGG   Pangasianodon hypophthalmus (striped catfish): 113535350
Entry
113535350         CDS       T05759                                 

Definition
(RefSeq) acid-sensing ion channel 1A-like
  KO
K04829  acid-sensing ion channel 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phyp04040]
    113535350
Ion channels [BR:phyp04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   113535350
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 113535350
NCBI-ProteinID: XP_026784411
Position
Unknown
AA seq 501 aa
MNAAKTMDVKVEPAAEIDRDHPPPLQVFALTSTLHGIAHIFSNERVTARCCLWLLFFLGS
LGFLLYVCMDRVQFYLEFPYVTKVDEIVAPAMLFPAVTICNLNSFRFSKVTRNDLYHAGE
LLAMLNSRYEIRDVHLVEESVLEALKIKADFQNFKPRPFNMLEFYNRTGHDIRDMLLSCH
FRGKPCRPEDFKVVFTRYGKCYTFNSGESGPPLLSVKGGMGNGLEIMLDIQQDEYLPVWG
ETDETSFEAGIKVQVHSQSEPPFIDQLGFGVAPGFQTFVSCQEQRLVFLPPPWGNCKMNS
QDSDFFSTYSLSACRIDCETRYLVENCNCRMVHMPGDAPYCSPELYKVCVDSALAYLLER
DNEYCMCETPCNTTRYSKELSFVKIPSKASAKYLAKKFSKSEKYITDNVLVLDVFFEALN
YETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVAKYKLCRCSDKKHQNN
SSDHDTVMGLNDVKCHVSQFH
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaacgccgccaagacgatggatgtgaaagtggagccggctgcagagatagacagagat
catccgcctcctctccaggtgttcgctctcacgtccacgctgcacggcatcgctcacatc
ttctccaacgagagagtgacggcgagatgctgcctgtggctgctcttcttcctcggctcc
ttgggcttcctgctgtacgtctgcatggaccgagttcagttctacctggagtttccgtac
gtcaccaaagtggacgagatcgtggctcctgccatgctgttccccgccgtcaccatctgc
aacctcaactccttccgcttcagcaaggtgacgcgcaacgacctgtaccacgcaggggag
ctgctcgcaatgctcaactccagatacgagattcgggatgttcacctggttgaggagagc
gttctggaggctctgaagatcaaagctgacttccagaactttaagcctcgaccatttaac
atgctcgagttctataaccgaacgggccacgacatcagagacatgcttctctcgtgccac
ttcagggggaaaccatgtcggcctgaagacttcaaagtggtgttcacacgctatgggaag
tgctacacatttaactcgggtgagagcggtccaccactgctcagtgtgaagggcgggatg
gggaacggcctggagatcatgctggacatccaacaggatgaatatttacctgtgtgggga
gaaacagacgagacgtcttttgaagcagggatcaaagttcaggttcacagtcagtctgag
ccgccgttcatcgatcagctgggttttggcgtcgctccaggattccagacctttgtgtcc
tgccaagagcagcggctggtgttcctgccacctccgtgggggaactgcaagatgaattcg
caggactccgactttttcagcacttacagcctcagtgcatgtcgcatcgactgcgagacg
cgctatctggtggagaactgcaactgccgcatggtgcatatgcccggtgacgccccgtac
tgcagccctgagctctataaagtgtgtgtagactcggcactcgcgtacctgttggagagg
gataatgagtactgcatgtgtgagactccgtgcaacaccacacgctacagcaaggagctc
tctttcgtcaagatccccagcaaagcctccgcaaaatacctcgcaaagaaattcagcaag
tccgagaagtacatcacagacaatgttctcgttctcgatgtctttttcgaagctctgaac
tatgagaccattgagcagaggaaagcctatgaagtagcaggactgctgggtgatattgga
ggacaaatgggactcttcattggagcgagcattctcaccattctggagctctttgattat
ctgtatgaggtagcaaaatacaagttgtgtcgctgctcagacaagaaacatcagaacaac
agcagtgatcacgacacggtgatggggctcaatgacgtcaaatgtcacgtcagccagttt
cattag

DBGET integrated database retrieval system