KEGG   Pangasianodon hypophthalmus (striped catfish): 113535609
Entry
113535609         CDS       T05759                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp00240  Pyrimidine metabolism
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113535609 (dck)
   00240 Pyrimidine metabolism
    113535609 (dck)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     113535609 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 113535609
NCBI-ProteinID: XP_026784850
Position
Unknown
AA seq 263 aa
MSRTPKRACSSSLNDSLEKRLKRISVEGNIAAGKSTFVRLLEQHDKEWEVVPEPIARWCN
VQTQHDEFEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRVRAQINSASGKLRHAE
NPVQFFERSVYSDRYIFAANLYESECLNETEWAIYQDWHTWLHKKFGQHIELDGIIYLQA
KPERCLERLHLRGREEEQGIPLEYLEKLHYKHECWLQHRTLRMDFDYLCEVPVLTLDVND
DFKGDKSKCVDMIEKVKDFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctcgtactccaaaaagagcttgttccagttctctaaacgacagtctggagaagaga
ttaaaacggatttctgttgagggaaacatcgcggcgggaaagtccacgttcgtgcgcctg
ctggagcagcatgataaagagtgggaggtggtgcccgagcccatcgccaggtggtgcaac
gtacaaactcagcatgacgaatttgaggagctgaccacatctcagaagagtggggggaac
gtgttgcagatgatgtatgagaagccggaacgctgggcttacacattccagagttatgca
tgcatgagccgtgtgcgcgcccaaatcaactcggccagtggcaaactgcgccacgctgag
aaccctgtgcagttcttcgagagatctgtctacagtgacaggtacatctttgcagcgaat
ttgtatgagagtgagtgtttaaatgagactgagtgggccatttatcaggactggcacact
tggctgcataaaaaattcggccagcacattgagctggatggcatcatttacctgcaggcc
aaaccagagaggtgtttggagaggttgcatttgagaggcagagaggaggagcaagggatt
ccgctggagtatctagagaaactccattacaaacacgagtgctggctgcagcacaggacc
ctgagaatggactttgactatctttgtgaggttcctgttctcactctggacgtcaacgat
gactttaaaggcgataaatccaaatgcgttgatatgatcgaaaaggtgaaagactttctc
agcactctatga

DBGET integrated database retrieval system