KEGG   Pangasianodon hypophthalmus (striped catfish): 113537166Help
Entry
113537166         CDS       T05759                                 

Definition
(RefSeq) erlin-2 isoform X1
  KO
K23341  erlin
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:phyp04121]
    113537166
Ubiquitin system [BR:phyp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    113537166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Hint
Motif
Other DBs
NCBI-GeneID: 113537166
NCBI-ProteinID: XP_026787321
Position
Unknown
AA seq 329 aa AA seqDB search
MKVRMTAGAVVSVILAIGGAALFSSVHKIEEGHTAVYYRGGALLTATSGPGFHLMLPFIT
TYKSVQTTLQTDEVKNVPCGTSGGVMIHFDRIEVVNYLIPSAVYGIVRNYTVDYDKALIF
NKVHHELNQFCSVHTLQEVYIGLFDQIDENLKLTLQEDLTHMAPGLIIQAVRVTKPNIPE
AIRRNYELMETERTKLLIAAQTQKVVEKEAETERKRAVIEAEKIAQVSEIKFGQKVMEKE
TEKKISEIEDSAFLARQKAKADAEFYTAQRAAEANKMKLTPEYLQMMKYKAIAANSKIYF
GSEIPRMFLDSRSTSKPMDLLSEDVLNMD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaggatgacggcgggagccgtggtgtcggtgatcctggccatcggaggcgcc
gcgctcttttcctccgttcacaagatcgaagaaggacacacggctgtttactacagaggt
ggagctctgctgacggccaccagcggcccgggttttcacctcatgctgcccttcatcacc
acctacaagtccgtacagaccacacttcagacagatgaagtgaaaaacgttccttgtggc
acaagtggtggagtgatgatccatttcgatcggatagaagtggtgaactacctcataccc
tcagctgtgtatggtattgtgaggaactacacggtggactacgacaaagctctgatcttc
aacaaagtgcaccatgagctgaaccagttctgcagcgtacacacacttcaggaggtttac
atcggcctgttcgatcagattgatgagaatctgaagctcaccctgcaggaggatctgacc
cacatggctcctggtctcatcattcaggctgttcgtgtcactaaacccaacatccccgag
gcaatccgcagaaactatgagctcatggaaacggagcgaaccaagctgctgattgccgca
cagactcagaaggtggtggagaaggaggcggagactgagaggaaacgagctgtgattgag
gcagagaagattgctcaagtgtccgagatcaaatttggacagaaagtgatggagaaggag
acggagaaaaagatatcagaaattgaggacagcgcgtttctcgctcggcagaaagctaaa
gcagatgctgagttttacacggcgcagagagcagctgaagctaataagatgaagctgact
cccgaatacctgcagatgatgaaatacaaagcgatagcagctaacagtaagatctacttc
ggcagcgagatcccccgcatgttcctcgactccaggagcacgtccaaacccatggacctt
ctctctgaggacgtcctgaacatggactga

DBGET integrated database retrieval system