KEGG   Pangasianodon hypophthalmus (striped catfish): 113537510Help
Entry
113537510         CDS       T05759                                 

Gene name
tpp2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phyp01002]
    113537510 (tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:phyp03110]
    113537510 (tpp2)
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     113537510 (tpp2)
Peptidases and inhibitors [BR:phyp01002]
 Serine peptidases
  Family S8: subtilisin family
   113537510 (tpp2)
Chaperones and folding catalysts [BR:phyp03110]
 Intramolecular chaperones
  Subtilisin family
   113537510 (tpp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 113537510
NCBI-ProteinID: XP_026787822
Position
Unknown
AA seq 1263 aa AA seqDB search
MATRSVEDSFPLHGLLPKKETGAASFLTRFPEYDGRGVLIAILDTGVDPGAPGMQTTTEG
KPKIVDIIDTTGSGDVNMSTVVEPKDGEVLGLSGRTLKIPPAWVNPSGKYHIGVKNGYEF
FPKPLKERIQKERKEKMWDPAHRAALAEASRKTEEFDLAHPSPSQMEKLQKEELQSHSEL
LSTMEKKYSDPGPVYDCVAWHDGITWRAVVDTSESGDLVSCTVLSSYRERQEYATLGDAE
MLNYSINIYDEGNTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQVLALKIGDTR
LSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVISEAVQKHNVMYVSSA
GNNGPCLSTVGCPGGTTSSVIGVGAYVTPDMMVAEYSLREKLPPNQYTWSSRGPSTDGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKQNGIRPTVAAVRR
ALENTAQKVDDIEVFAQGHGIIQVERAFDYLMQHASTPTSNLGFTVTVGNQRGIYLRDAV
HVSTPSDHGVGIEPVFPENTENSVRISLQLHLALTCSAPWVQCPSHLELMNQCRHVNVRV
DPQGLREGLHYTELCAYDTSAPSAGPLFRVPITVIIPTKVTESQNQDVSFTDIHFRPGQI
RRHFITVPQGASWAEITLTSHSPDVSSKFVLHAVHLVKQRAYRANEFYKFSSLLEKGSLT
EAFPVLPGRTVEVCIARWWASLGDVIVDYTISFHGLQTSPCPLHIHAAEGITSFEVSSPI
RYEEVSPAITLKNWVQPLRPISSKTKALGSRDVLPNNRQLYEIVLTYNFHQPKSGEVTPS
CPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYPHQYSLKLEKGDYTIRLQVRHEQQSE
LERLKDLPFVVSHRLSNTLSLDVYETHRAALLAKKKANSLTLAPGASQPFYITSLSDDKI
PKGTGPGCYMTGSLVVPKSEYGKKAGQASAKRQGKFKKDIVPIFYHLISAPNKSKNGGKE
KDKDGEKEKDVKEEFSEALRDLKIQWMTKLDNNTLYDELKENFANYLPLHVQRLHQLDSE
KERLKRLQDIVAAADIVISHIDQTALAVYLTMKTDPRPDAASIKSDMEKQKSSLLDALCR
KGCALADQLMQPPEQEGASASEVGSSEEDPHGVAKALTDTFWEVQKWAELTDSKVLSFSY
KHALASKMYGRALKYASKIVEDKPSKENWKNCIQLMRSLGWMHCTTYTENWLPVMYPSDY
TPF
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atggctactcgctctgttgaagactcctttcctttacacgggctgctgccgaaaaaggag
accggcgctgcttcattcctgaccaggtttcccgagtacgatggacggggggtccttatc
gccattctggataccggggtggacccgggggcgccgggcatgcagaccacgacagagggc
aagcctaagattgtggacatcatcgatacgacaggcagtggcgatgtcaacatgtccaca
gtggtggagccgaaagatggagaagtgcttggactttctggacgcacactcaagatccct
cctgcctgggtgaacccatcaggaaaatatcacatcggtgttaaaaatggttatgagttt
tttcccaaacctctcaaagagaggatacagaaagagcgcaaggagaagatgtgggacccg
gcacacagagcagctctagccgaggccagtcgcaagacggaggagtttgacctggctcac
cccagcccctcacagatggagaagctgcagaaggaggagttgcagagccacagtgagctg
ttgagcaccatggagaagaagtacagcgaccctgggccagtgtacgactgcgtggcttgg
cacgatggcatcacctggagggcagtggtggatacttcagagagtggagacctggtgtcc
tgtaccgtgctcagctcctacagagaaagacaggagtacgccacgctaggagatgctgag
atgctcaattactccatcaacatctatgatgaggggaatactctctgcattgtcactagt
ggaggtgctcatgggactcacgtcgccagcatagcggcaggttacttccccgaggagcca
gagagaaacggcgtggcccccggtgcccaagtcttggcactgaaaataggggatactcgc
ctgagcacaatggagacaggaacaggcctcatccgagcgatgatcgaggtgattaactac
aagtgtgaccttgtgaactacagctatggggaggccacacactggccaaactcagggaga
atctgtgaagtaatcagtgaggcggtgcagaaacataatgtcatgtatgtgtcgagcgct
gggaacaacgggccatgtctctccactgtgggatgtccgggaggaaccacaagtagtgtc
ataggcgttggtgcttatgtcacgcctgacatgatggtggcagaatattccctgagggag
aagctgcctcctaaccagtacacgtggtcctcaaggggtcccagtactgatggagctctg
ggtgttagcatcagtgcgccggggggagccatcgcctctgtgcccaactggactttgcgt
ggcacgcagttaatgaacggcacctccatgtcctctcccaacgcctgtggaggcatcgca
ctcatactctcaggtctgaagcagaacgggatacgacccacagttgcagctgtgagacgt
gctttggaaaacacagcccagaaagtggatgacattgaagtgtttgcgcagggtcatggc
attattcaggtggaaagggcgtttgactacctcatgcaacatgcttccactcccaccagt
aacttgggcttcacagtcactgtagggaatcagcggggcatctacctcagggacgccgtc
cacgtctccactccctctgatcacggagttggcattgagccagtctttcctgaaaacact
gaaaactctgtacgaatctcgctgcagttgcacctggcgctcacatgcagcgcgccgtgg
gtgcagtgcccctctcacctggagctcatgaaccagtgccgtcatgttaatgtccgtgtc
gacccacagggccttcgagagggcctgcattatactgagctgtgtgcttatgatacctct
gcacccagtgctggtcccctcttcagagtccccataacggttataatccccacaaaggta
acagagagccagaatcaggatgtctccttcacagacattcacttcagaccaggccagata
cggcggcattttatcaccgtccctcaaggagcctcatgggcagagatcacattaacgtct
cactcccctgatgtctcctccaagtttgtcctccatgctgtgcacctggtgaagcagagg
gcttaccgagctaatgagttctacaagttctcctcactgctggagaagggctcgctcaca
gaagctttccctgtgctgcctggtcgaacggtggaggtgtgcatcgctcgttggtgggcc
agtcttggtgatgtcatcgtagactataccatttccttccatggactgcaaacgtctccc
tgtcctcttcatatacatgctgctgagggcataaccagttttgaggtgtcatctcctatt
agatatgaggaggtctcaccagccatcaccctgaagaactgggtgcagccacttaggcca
ataagttcaaaaacaaaagcgcttggctccagagacgtcttgcccaacaaccgtcagctt
tatgaaatcgtccttacatacaactttcaccagcctaaaagtggagaggtgacccccagt
tgtccactactgtgtgagctgctatatgagtctgagtttgacagccagctctggctcctc
tttgaccagaacaagagactcatgggctctggagatgcttatcctcaccagtactctctg
aagctggagaaaggggactacaccatccggctgcaggttcgccatgagcagcagagtgag
ttggagcggctgaaagatctgcctttcgtagtgtctcatcgcctctccaacacgctgagc
ctggacgtgtatgagacacaccgggcggccctgctggctaagaagaaagcaaactcgctc
actctcgcaccaggagcctctcagccattctacatcacctctctatcagatgacaagata
cctaaaggtacaggtccggggtgctacatgaccggctctctggttgtaccgaagagcgag
tacgggaaaaaagcaggccaagcctcagccaaacgacaaggaaaatttaaaaaggacatc
gtgccaattttctaccacttgatctcagccccaaacaaatcaaagaatggaggaaaagag
aaggacaaggatggggagaaagagaaggatgtgaaggaagagttctctgaagccctacga
gacttgaagatccagtggatgaccaagctggacaataatacattatatgatgaactgaag
gagaactttgcaaattatctccctctccatgtccaacggctgcatcagctggattcagag
aaggagcgtctgaagcgattgcaagacatcgtggcagcagcagatattgttatctctcat
attgaccagactgcactggcagtgtatctcacaatgaagacagaccctcgtccagacgca
gcctccataaagagtgatatggagaaacagaagtcgtcactgctggacgctctctgtagg
aaaggctgtgctctggctgatcagctcatgcagcctccagagcaggagggggcgagcgcg
agtgaggtgggcagctctgaagaagacccgcatggagtggctaaagctctgaccgacact
ttctgggaggtccaaaagtgggctgagctcactgactctaaggttctgtcattttcctac
aaacatgccttagcaagtaaaatgtatggaagagccttgaaatacgcttctaaaattgta
gaagacaaacccagcaaagaaaactggaagaactgcattcagctgatgaggtctctgggc
tggatgcactgcaccacctacaccgaaaactggcttcctgtcatgtatccctcagactac
acgcctttttaa

DBGET integrated database retrieval system