KEGG   Pangasianodon hypophthalmus (striped catfish): 113537943
Entry
113537943         CDS       T05759                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:phyp04040]
    113537943 (asic1)
Ion channels [BR:phyp04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   113537943 (asic1)
SSDB
Motif
Pfam: ASC zf-UBP_var
Other DBs
NCBI-GeneID: 113537943
NCBI-ProteinID: XP_026788489
Position
Unknown
AA seq 557 aa
MVRITCTISVTTGDEPTAGSYASSFDDHYKRVVRSGDSDPGLYKEECDELEVYEEEEEEE
PPNIDLATFFSGCSLHGANHVFVENKKFGVRQGLWAVCFLVALSLFLIQVGDRVVYYMQY
DHVTMLDERNAPNMTFPAITLCNYNTFRRSQISYSDLLFMGPLIGYEDNMAPGFQLAPEP
DRQGARFSMAEFYNRTRHRMDDMLLECNFAGKDCGPEHWREIFTRYGKCYTFNSGQDGQP
LRITTKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFGV
APGFQTFVSCQEQRLTYLPPPWGDCRSEPMDSDFFTTYSITACRIDCETRYLVENCNCRM
VHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRYGKELSFVKIPSKASA
KYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELPGLLGDIGGQMGLFIGASI
LTVLELFDYLYEVIKYKLCRCRKKNHKRSNNNDRGAVLSLDNVQCHPPCENLRTPSTYPA
NILPHHPGQGNFEDFTC
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggtgcgaattacatgcacaatctcggttacaacaggagatgagcccactgcggggtct
tacgcgagcagctttgatgaccactacaaaagggtagtgcggagtggcgacagcgatcca
gggctttacaaggaagagtgtgatgagctggaggtttacgaggaggaggaagaagaagag
ccccctaatattgacttggcaacctttttcagtggttgttcccttcatggtgccaaccat
gtctttgtggagaataagaagtttggagtgaggcagggtctctgggcagtgtgcttcctg
gtggccctctctctgttcttgatccaggtgggtgaccgtgttgtctattacatgcagtat
gaccatgttaccatgctggatgagcgcaatgcacccaacatgaccttcccagccatcact
ctctgcaactacaacaccttccgtcgttcccagattagctacagtgaccttctctttatg
ggaccactcatagggtatgaggacaacatggcacctgggttccagcttgcccctgagcct
gatcgccaaggtgcccggttcagcatggccgagttctataaccggacgcgacatcgtatg
gacgacatgcttctggagtgcaactttgctggaaaggattgtggccctgagcactggaga
gagatcttcactcgatatggcaaatgctacacattcaactctggccaggatggacagcca
ctccgtatcaccacgaaagggggtatgggcaacggcctggaactaatgctagacattcag
caggacgagtacctgccagtgtggggagagacagatgagacgtcttttgaagccggcatc
aaagtgcagatccacactcaggatgagccgcctttcattgatcagctgggattcggagtg
gcgccaggctttcagacgtttgtgtcctgccaggagcagaggttgacctacctgccccct
ccgtggggtgactgcaggtccgagcccatggactcagacttctttactacctacagcatc
acagcatgccgcatcgactgtgagacgcgctacctggtagagaactgtaactgtcgcatg
gtgcacatgcctggagatgctccatattgcacgccggaacagtataaagagtgtgctgat
ccagctttggatttcctggtggagagagacaatgattactgtgtgtgtgagacaccctgc
aacatgacacgctatggcaaagagttatccttcgtcaagatccccagcaaggcctcggcc
aaatacctggccaagaagttcaacaagacagagcagtacattgcggataacatcttggtt
ctggatatctacttcgaggctttgaactatgagactattgagcagaaaaaggcctatgag
ctgcctggattactgggtgatattggtggtcagatgggtctttttattggagccagtatt
ctgacagttttggagctctttgactatctttatgaggtgatcaagtacaagctgtgccgt
tgcaggaagaagaaccacaaacgcagcaacaacaacgaccgaggagccgtgctgagcctg
gacaacgtgcagtgccatcctccatgtgaaaatcttcgtactccctctacatatccggcc
aacatcctacctcaccatccagggcagggcaacttcgaggacttcacctgctga

DBGET integrated database retrieval system