KEGG   Pangasianodon hypophthalmus (striped catfish): 113538008
Entry
113538008         CDS       T05759                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113538008 (rdh5)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     113538008 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 113538008
NCBI-ProteinID: XP_026788604
Position
Unknown
AA seq 348 aa
MTFVVWNLHHSALPMDMELIYEYISKDHLFSYALGAFVLLWALIWLYRDSLEIDKIKEKY
VFVTGCDSGFGNLLCKRLDKRGFRVLAGCLTEKGADDLKRVTGPYLKTCILDVTRTASIQ
NAVEWTKKEVGDRGLWGIVNNAGCSLPMGPSEWMQIEDFHSTLRVNMTGVIETTMNFLPL
VKRARGRIVNVASVLGRVAANGGGYCISKFAVEAFSDCLRRDIQHFGIKVCIIEPGFFKT
QVTSLEPLERELHRLWNQLTPEVKESYGEKYLDKYINVQRLIMNAICDADLSKVTNCMEH
ALSAAHPRTRYSAGWDAKLLWIPLSYMPACVVDIALRLVLPRPAKSVL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgacctttgttgtttggaacctgcatcattcagcactccccatggacatggagctaata
tacgaatatatcagtaaagatcacctgttctcgtacgctcttggtgcctttgtgctgttg
tgggctttgatatggctgtaccgtgacagcctggaaatcgacaaaatcaaagagaagtac
gtgttcgtcaccggctgtgattcaggtttcgggaacctattatgtaaacgactggacaaa
cgtggtttccgtgtgttggctggttgcttgacagaaaaaggagcagatgacctgaagaga
gtgacgggaccttatctgaagacctgcatactggatgttactagaacagctagcattcag
aacgctgtggaatggacgaagaaagaggttggagacagaggactctgggggatcgtgaac
aatgcaggatgctcgttacccatgggtccttctgaatggatgcagattgaggatttccac
agcactctaagggtcaacatgactggtgtgatcgagacgaccatgaattttctgccactc
gtcaagagagcccgtggccgaattgttaatgtggcttcagtgctgggcagagtggcagcg
aacggaggtggatactgcatttccaagtttgcagtggaagccttttctgattgcctcagg
agggacattcaacattttggaatcaaagtgtgtataatagaacctgggttcttcaagacc
caggtgacaagcctggaaccactcgaacgggaacttcatcgcctgtggaaccaactgacg
cctgaagtgaaagaaagctatggagaaaaatatctggataagtacatcaacgtacagagg
ctgattatgaatgctatttgtgatgctgatttgagtaaagtgaccaactgcatggagcat
gctctgtctgctgctcacccaaggacccgatacagtgctggctgggatgccaaactcctc
tggatccctctctcttacatgccagcttgtgttgttgacattgcactaagactggtgttg
ccacggcctgccaagagtgttttatag

DBGET integrated database retrieval system