KEGG   Pangasianodon hypophthalmus (striped catfish): 113538178Help
Entry
113538178         CDS       T05759                                 

Gene name
sucla2
Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00020  Citrate cycle (TCA cycle)
phyp00640  Propanoate metabolism
phyp01100  Metabolic pathways
phyp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113538178 (sucla2)
   00640 Propanoate metabolism
    113538178 (sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phyp04147]
    113538178 (sucla2)
Enzymes [BR:phyp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     113538178 (sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     113538178 (sucla2)
Exosome [BR:phyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113538178 (sucla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A WIYLD
Motif
Other DBs
NCBI-GeneID: 113538178
NCBI-ProteinID: XP_026788856
Position
Unknown
AA seq 493 aa AA seqDB search
MAASLICGRLSAGLRNSGSRTALSSTAKVITGTSGLFGNHGHQPSPLATGQQQRNLSLHE
YLSIGLLKEAGISVPAGLVASSPDEAYAAAKQIGSKDLVVKAQVLAGGRGKGTFEGGLKG
GVRIVYSPEEARDISSQMIGKKLFTKQTGEAGRICNQVFICERRYPRREYYFAITMERSF
QGPVLIGSSQGGVNIEDVAAENPDAIVKEPIDIVEGIKMEQAIKVAKKMGFPEALVNEAA
ENMIKLYNLFIKYDASMVEINPMVEDSSGIVMCMDAKINFDSNAAYRQKKVFDLQDWTQE
DVRDRQAARADLNYIGLDGTIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATAHQV
TEAFKLITSDKKVQAILVNIFGGIMRCDVIAQGIIMAVSDLDLKIPIVVRLQGTRVDDAK
ALIAASTLKILACDDLDEAAKMVVKYGRRLSVAICGVRVDKAYSTSKLRSALIQSCCVLM
GLRACLLVRRGHG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccctgatctgcggccgattgtccgctggactgaggaattccgggtccagg
acagctttaagttcaacagctaaggtaattaccgggacatcggggctgttcggtaaccat
ggccaccagccgtctccgctggcgacggggcagcagcagaggaacctgtcgctgcacgag
tacctgagcatcggcttgctgaaggaggcagggatctctgtgcctgcggggttggtggcc
agctcacctgatgaagcgtacgccgccgccaagcagatcggctctaaggatctggtggtg
aaagctcaggtgttggctggaggaagaggcaaaggaacgtttgagggaggattaaaaggc
ggagtcagaatcgtttactcgccagaggaagcgagggacatctcctcacagatgatcggc
aagaagctgttcaccaagcagacgggcgaggcgggccgcatctgtaaccaggtgttcatc
tgcgagcgccgttatccccgcagagagtattacttcgccatcaccatggagagatctttc
cagggcccagtgctgattggcagctctcaggggggcgtaaacatagaggacgtggcagct
gaaaatccggacgccatcgtgaaagagcccatcgacatcgtagagggcatcaagatggag
caagccataaaggttgctaagaagatgggtttccccgaggctttggtaaacgaagcggcc
gagaacatgatcaaactctacaacctttttatcaaatacgacgcatctatggtggagatc
aaccctatggtggaagactcctctggcattgtgatgtgcatggacgctaagatcaacttt
gactccaacgctgcgtacagacaaaagaaagtgttcgacttgcaggactggactcaggag
gatgtccgagacagacaggcggctagagctgatctgaactacatcggcctggacggcacc
atcggctgcttggtcaacggagccggtctcgccatggcaaccatggacatcattaaactc
cacggcgggacgcctgccaacttccttgacgtaggaggcggagccacggcgcatcaagtg
acggaagccttcaagctcatcacctcagacaaaaaggtgcaggccatcctcgtcaacatt
ttcggtggcattatgaggtgtgacgtcatcgctcagggcatcatcatggccgtcagcgac
ttggacctcaaaatccccatcgtagtgcggttacaaggaacgagagtggatgacgcaaag
gctttaatcgctgcgagtactctgaagatcctggcctgtgatgacctggatgaggcggct
aagatggttgtaaaatatggcaggcggctctctgtcgccatatgtggcgtgcgtgtggac
aaggcttactccacttcaaagctgcgctctgctctaattcaatcatgctgcgtcctaatg
ggattgagagcttgtctgctcgtccgtagaggacatggttaa

DBGET integrated database retrieval system