KEGG   Pangasianodon hypophthalmus (striped catfish): 113538595Help
Entry
113538595         CDS       T05759                                 

Gene name
plk4
Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113538595 (plk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113538595 (plk4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phyp03036]
    113538595 (plk4)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     113538595 (plk4)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   113538595 (plk4)
Chromosome and associated proteins [BR:phyp03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113538595 (plk4)
   Centrosome duplication proteins
    Regulators of centriole replication
     113538595 (plk4)
  Sister chromatid separation proteins
   Polo kinases
    113538595 (plk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like Glycos_trans_3N Kdo
Motif
Other DBs
NCBI-GeneID: 113538595
NCBI-ProteinID: XP_026789565
Position
Unknown
AA seq 935 aa AA seqDB search
MSVSIGDKIEDFRVLTLLGKGSFACVYRAKSVNTGLEVAIKMIDKKAMHKAGMVQRVINE
VEIQCRLKHPSVLELYNYFEDSNYVYLVLEMCHNGEMSRYLKDRKKPFTEEEVRHFMHQI
VKGMLYLHTHGIMHRDLTLSNLLLTSSMNIKIADFGLATQLKLPSEKHFTMCGTPNYISP
EVATRSAHGLESDVWSLGCMFYAFLTGRPPFDTDTVKHTLSKVVLGEYQMPTHVSAEAQD
LIQLLLQKNPALRPSLSAVLDHPFMTQSGSTSSKDSGGSDGGSMDSGIATISTASNTTSN
SSSSRLHRKTRQVIGQALPNRMVPLPSHSQQSSSSSLKGEQDWQPHAPGSVRVPVELVSG
RPHSRYLRRAHSSDRSGAGYSHARQEVELERCHSEEVLPGSGRIFPSTSNYQDNGNGYAG
HGRLPSPPVKQPASSGSSFSAPVHPIRLQTAESSTQPWFSTDGSFKRPADVSSYSSSGSF
HSGREAVGALPSCSDQPTVRATSGLPPQLYHQSSSHSDPGPCREDGFGMSHFPTPQGCVD
VQNAPLSRSKANEGKEKKSPLFPPLCAARLKPIRQKTKNAVVSILDTGEVCMELLKGQGA
QERVKEVLRISSDGSMVTVYQPNEGKGFPVLDHPPSPPEDIFICSYEDLPEKYWKKYQYA
TKFVQLVKSKTPKITLYTKFAKCMLMENSPNSDLEMCFYDGAKTHKTSEQVRVVEKSGKS
YTVKGDVGLSGISPECRRYMELTDEGHRMCLSLEAAISAEEQRSAGATPFFPITIGRRPT
NSASSCPVAQPASEQAPTAPGEVAQVCLSPPHQLHITPSMISYSGSDFTTASLAKVSSPR
SAKDGCSISAGKVLKSIFVPNIGWASQLTSGEVWVQFNDGSQLVVQAGVSCITFTSPEGH
ITRYKENEKLPELVKEKLHCLSSILSLLASPAARR
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctctatcggcgataaaattgaggacttcagagttctcaccttgctcggtaag
ggctcctttgcctgcgtctacagagccaaatctgtcaacactggcttggaagtggcaatc
aaaatgattgataagaaggccatgcacaaagctggcatggtgcaacgtgtcattaacgag
gtggagatccagtgtcggttaaaacacccctcagtgctggagctgtacaattactttgaa
gacagcaattatgtgtatctggtcctggagatgtgccataacggagaaatgagccgttat
ctgaaagacaggaagaagcctttcacagaagaagaagtgagacacttcatgcaccagatt
gtgaagggcatgctgtatctgcacactcatggcattatgcacagagacctgactctgtcg
aacctgcttctcaccagtagcatgaacattaaaatcgccgactttggcttggccacgcag
ctcaagctgcctagtgagaagcacttcaccatgtgtggcactcccaactacatctctcct
gaggtggccactcggagtgcccacggcctggagtcggacgtctggtctctgggctgtatg
ttctatgcctttctgacgggcaggccccccttcgacacagacactgtcaaacacaccctc
agtaaagtggttttaggggagtaccagatgcccactcatgtgtcagctgaagctcaggat
cttattcagcttctgctgcagaagaatcctgccctgaggcccagcctgtcagcagtgcta
gaccaccctttcatgactcagagtggatccacgtcaagtaaagactctgggggcagtgat
ggaggctccatggacagtggcatagcgacgatatctacagcgtccaacactaccagcaac
agcagcagcagtcggctccacaggaaaaccaggcaggtgattgggcaggccttacccaac
cgcatggtgccactgcccagccattcgcagcaatccagcagctccagccttaagggagag
caggactggcagccacatgcaccaggcagtgtgagggttcctgtggagcttgtcagtgga
aggcctcattctcgctacctgagacgggctcactcctctgatcgctctggtgctggctat
agccatgctaggcaggaggtggagctggagcgatgccactcggaggaggtgcttccggga
tctggtcgcattttcccatcaacctccaactatcaggacaacggcaatggctatgctgga
catggacgtctaccctctccacctgtcaaacagcctgcaagctctgggtcttccttttct
gctccggtgcatcctattagattacagacagcagaatctagcacacagccatggttcagc
accgatggttctttcaagagaccagcagacgtcagcagttacagcagcagtggtagtttc
cattctgggcgagaggcagttggggctctgccttcctgcagtgatcaaccaacagtgaga
gcaacaagtggccttcctcctcaattataccaccaatcctcctctcacagtgaccccggt
ccctgtagggaggatgggttcggaatgagccacttcccaacacctcagggctgtgtggat
gtccaaaatgctcccctgtccaggagcaaagctaatgagggaaaggagaagaagagtcct
ctgtttcctcctctctgtgcagccagactgaagcccattcgacagaagaccaaaaatgct
gtggtcagtatcctagatacaggagaggtgtgtatggagcttctaaaaggccaaggagct
caggagagggtcaaggaagtactgaggatatcctctgatggctccatggtgactgtgtac
cagcccaatgaggggaaaggcttccctgtgctggatcatccgccctctcccccagaagac
atttttatatgcagctatgaagatttaccagagaagtactggaagaagtatcaatatgcc
accaagtttgttcagttggtgaaatcaaagactccaaaaataaccttgtacaccaagttt
gccaagtgcatgttaatggaaaattctcccaattcagacctggaaatgtgcttctatgac
ggtgcaaaaacccataagacaagcgaacaggtgcgagtggtggagaaaagtggcaagtcg
tacacagtgaaaggggatgtaggtttaagcggcataagccctgagtgcagacgttacatg
gagctcacagatgaggggcacaggatgtgtctgtctctggaggctgccatcagtgctgag
gagcagcgtagtgctggagccactccattcttccccataactatcggcaggaggcccact
aactctgcctcctcctgcccagtggcccagcctgcctctgaacaggctcctacagctcct
ggtgaagttgctcaggtgtgcctgagtccacctcaccaactccacatcaccccttctatg
atttcctacagtgggtctgattttacaacagccagtttggctaaagtcagctccccgcgc
tcggccaaagatggatgtagcatcagcgcaggaaaagtgctgaagtccatctttgtaccc
aacatcggctgggcctctcagctaacaagtggagaagtctgggttcagtttaatgatggg
tcccagctggtggtccaggcaggcgtctcctgcatcacattcacctctcctgaaggacac
atcacccggtataaggagaatgagaagttacctgagctggttaaggagaagctgcattgc
ctttcatccattctcagccttttggcgagtcctgctgcacgacgctga

DBGET integrated database retrieval system