KEGG   Pangasianodon hypophthalmus (striped catfish): 113539114Help
Entry
113539114         CDS       T05759                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp01100  Metabolic pathways
phyp04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113539114
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    113539114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113539114
Enzymes [BR:phyp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113539114
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   113539114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 113539114
NCBI-ProteinID: XP_026790472
Position
Unknown
AA seq 1105 aa AA seqDB search
MQQFPLHFGGALLDLSSCPCCNVLRSKHSLSTLPFFNLWTILAVLTFPCCVQCLIFKVGV
VGPWNCDPVYSKTLPAVASKLAISRINKDVSLDLGCTMDFVVLQEPCETSKALTTFVYYE
KEADAFIGPGNPGYCNAATLLGKNWDKAIFSWACINYELERIQSYPTFARILPSPTRVLY
TVLKYFSWANIGIVSSNEDIWVDAATKLASSLRNQGLPIGIVASIGNNDTEMENTLRNIQ
NAGEIKVIIMCMHSVLIGGEKQLNFLLKAYDMGLTSGSYVFIPYDALLYSLPYTNISYFA
ILNNTKLRTAYDAVLTITVASDLMSFNQAFNKAKEQQELTITQDPQQVSPLFGTIYNGFY
LLAKAMHNTRRASQWFSGTNLAFYTRNLTFPGFNQNIQIDSQGDGQTNYVILDSDGWGTD
LYLCYLVDLGSNMVRYAGRSIHYPGGSGPSADSSCWFNPKTICTGGVDIIYVIIVFAIVF
VFIIGAIGISLLIRRRIQQLQLVKGPNRILLTLEDLSFINPQLSKRKITLEELSDSKSIA
DEKSMRSAEHSVNSLAAATHETSNVAVYEGDWVWLKKFEKGQFKEVKQSTTKIFTKMKDL
RNENVNPFLGFFCDCGMFAVVTEHCSRGSLQDLLRNDDVKLDWMFKSSLLLDLIKGMKYL
HHREFPHGRLKSRNCVVDGRFVLKITDYGFNELLESQKSPKEEHSPEDLFWTAPELLRDP
ESPRKGTFKGDVYSFAIILQEVVVRGAPYCMLGLPPEEIIRKVKKPPPMCRPTVAPDQAP
LECIQLMKQCWSEQPDRRPTFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRE
RTEELEIEKQRTEKLLTEMLPPSVAEALKTGASVEPEYFDQVTIYFSDIVGFTTISSLSD
PIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNIL
SSVGSFKMRHMPDVPVRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYR
IHVNISTVKILQSLNEGYQIEVRGKTELKGKGIEETYWLVGKTNFTKPLPKPPEIKAGDN
WQDMVTEEIKAIFRKANRQVDKPKI
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatttcctctccattttggaggcgcactgttggacttatccagctgtccgtgt
tgtaacgtcctgagaagcaagcacagcctttcaacgctaccatttttcaacttatggacg
attctggccgttttgacttttccctgctgtgtgcaatgcctcatttttaaagtcggggtc
gtcggcccttggaattgcgaccctgtctattccaaaacattacctgctgtagcttcgaag
ttagccattagtagaataaacaaggatgtcagtttggacctgggctgtacgatggacttt
gtggttctccaagaaccgtgtgaaacctcaaaagcactgacgacatttgtgtattatgaa
aaagaagctgatgcttttatcggacctggaaatccaggatactgtaatgcagcgacactc
ctgggaaagaactgggataaagctattttttcatgggcctgcatcaactatgagctcgaa
cgaattcagagctacccaacatttgcccggatcttgccgtcacctacacgggtgctgtac
actgtcttgaagtatttcagttgggccaacatcggtatcgtttcctctaatgaggacata
tgggttgacgctgctaccaaactggctagctctctcaggaatcagggacttcccataggc
attgttgcctcaattggaaataacgacacagagatggagaatacactgagaaacatccag
aatgcgggggaaatcaaagttatcatcatgtgcatgcattcggtgctgattggcggtgaa
aagcagctgaatttcctgctaaaggcctatgacatggggttaacaagtggcagctatgtc
tttataccatatgacgctctactctacagcctgccctacaccaatatctcctattttgca
attctgaacaacaccaagctacgtacagcatatgacgctgtgctcaccattactgtagca
tccgatctgatgtccttcaaccaggcctttaataaagccaaagaacagcaggagttgacc
attacccaggatcctcagcaggtttctcccctttttggtacaatctacaatggtttttac
ctccttgccaaagccatgcacaacaccaggagagccagccagtggttctcaggaaccaac
ctggccttctacactcggaatctgacatttcctggcttcaatcagaacatccagattgac
tcacagggtgatggacagaccaactatgtcatcttggactcagatggctgggggactgac
ctgtacctttgctatttggtggaccttggttcaaacatggtgcgctatgctggcaggtct
atccactatcctgggggttctggtccttctgcagattccagctgctggttcaatcctaaa
accatctgcactggaggtgtggatataatctatgtcatcatagtgttcgcaattgtcttc
gttttcattattggtgccattggaataagtctgcttataaggaggcgaatccaacaactc
caactggtaaaaggacccaacaggatcttgcttactcttgaagatctcagtttcatcaat
ccccagctaagcaaacggaaaatcaccctggaggaactcagtgactccaaaagcattgct
gatgagaagagcatgaggtcggctgaacactcggtcaacagtttggcagcagccactcat
gagacctccaacgtggccgtctatgagggtgactgggtgtggctcaagaagtttgagaag
ggtcaattcaaggaagtcaagcagagtaccaccaaaatatttacaaagatgaaggatctc
aggaatgagaatgttaacccatttcttgggttcttctgtgactgtggcatgtttgctgtg
gtcacagagcactgctcaagaggaagcttacaggacctactgcgcaatgatgacgttaaa
ctagactggatgtttaagtcctccttgcttttggacctcatcaagggaatgaaatacctt
caccatcgagaattccctcatggccgactaaagtcacgcaactgtgtggtggatggacga
tttgtgctcaaaattacagattatggtttcaatgagcttcttgaatcccagaaatctcca
aaggaggaacattcaccagaagatctcttctggacagctcctgaacttctcagagaccct
gagagcccacgaaaggggacatttaaaggcgatgtgtacagctttgccatcatactccaa
gaggtggttgtccgtggcgctccatactgcatgcttggactaccaccggaagagattatt
aggaaggtgaagaaacctccccccatgtgcaggcctacagttgctccagaccaggctcca
ctagagtgcatccagctgatgaaacagtgttggagtgaacagcctgacaggagacccacc
tttgacgaaatatttgatcagttcaagcttataaacaaaggcaagaagaccaacatcata
gactctatgttgcgcatgctggaacagtactcctcaaatcttgaagatctaattagggag
aggacagaggagttggagatagagaaacagcggacagagaaactcctgactgaaatgctc
ccgccatctgtggctgaggcattgaaaacaggtgcctctgtggagccggagtactttgac
caggttaccatctacttcagtgacatagtgggcttcacaacaatctcctcactcagcgat
ccaatcgaggttgtggatctgctcaatgacctctacacactatttgatgcagtgttgtgt
aaccatgatgtatacaaggtggaaaccattggagatgcctatatggtggcctcaggactg
ccaaagaggaatggcaataagcatgcagctgagattgccaacatgtccctgaacatcctg
agctctgtgggatcttttaaaatgcgtcacatgccagacgttccagtcaggataagaata
ggcattcactcagggtcatgtgttgctggagtagtgggtctaacaatgcctagatactgc
ctttttggtgataccgtcaacaccgcctctcgtatggaatctacgggactgccttataga
attcatgtgaacataagcactgtgaagattctccaatcattgaatgagggctaccagata
gaagttagaggaaagacagagttaaagggtaaaggaattgaagaaacatactggcttgtt
gggaaaacgaactttacaaagcctttaccgaagcctcctgagatcaaagcaggggataac
tggcaggacatggtgacagaagagatcaaggcgattttccggaaggcaaacagacaagtg
gacaagcccaaaatctga

DBGET integrated database retrieval system