KEGG   Pangasianodon hypophthalmus (striped catfish): 113539432Help
Entry
113539432         CDS       T05759                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A-like isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04068  FoxO signaling pathway
phyp04114  Oocyte meiosis
phyp04218  Cellular senescence
phyp04261  Adrenergic signaling in cardiomyocytes
phyp04370  VEGF signaling pathway
phyp04620  Toll-like receptor signaling pathway
phyp04621  NOD-like receptor signaling pathway
phyp04622  RIG-I-like receptor signaling pathway
phyp04625  C-type lectin receptor signaling pathway
phyp04912  GnRH signaling pathway
phyp04914  Progesterone-mediated oocyte maturation
phyp04933  AGE-RAGE signaling pathway in diabetic complications
phyp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113539432
   04370 VEGF signaling pathway
    113539432
   04068 FoxO signaling pathway
    113539432
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113539432
   04218 Cellular senescence
    113539432
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113539432
   04621 NOD-like receptor signaling pathway
    113539432
   04622 RIG-I-like receptor signaling pathway
    113539432
   04625 C-type lectin receptor signaling pathway
    113539432
  09152 Endocrine system
   04912 GnRH signaling pathway
    113539432
   04914 Progesterone-mediated oocyte maturation
    113539432
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113539432
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113539432
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113539432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113539432
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113539432
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113539432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 113539432
NCBI-ProteinID: XP_026790971
Position
Unknown
AA seq 361 aa AA seqDB search
MSQKERPAFYRQELNKTIWEVPERYKNLAPVGSGAYGSVCSAYDVKTGLKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATTLEEFTDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDTRITA
SEALAHPYFAQYHDPEDEPEAEPYDQSFESRELDIEEWKRLTYEEVLSFEPPVFDGDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaggagagacccgctttctaccgacaggagcttaataaaaccatatgggag
gtacctgagaggtacaagaacctcgctccggtcggttcgggcgcttatggatctgtatgc
tcggcgtatgacgtaaagacgggcctgaaggttgctgtgaagaagctgtcacgacctttc
cagtccatcatccacgccaagcgcacctaccgagaactgcggctgctcaagcacatgaaa
cacgagaatgtgattggcctgttggatgtgttcacgcccgccaccaccctcgaggaattt
accgatgtgtacctcgtgactcacctaatgggcgctgacctcaacaacatcgtcaaatgc
cagaagctaacagatgaccatgtgcagttcctcatctatcagattttgcgtggcctaaag
tacattcattcagcagacatcatccacagagacctgaagcccagtaacctggctgtaaat
gaagactgtgagcttaagatcctggactttggccttgcaagacatacagacgatgagatg
acgggctatgtggctacacgatggtatcgtgcacctgagatcatgctcaactggatgcac
tacaacatgacagtggacatctggtctgtgggctgcatcatggccgagcttctcactgga
cggactctgtttcctggcactgatcatataaaccagctccagcagataatgcgcctgact
ggaactcctccagcctcactaataagcaggatgcccagccacgaggccagaaactacata
aattctttgccgcacatgccaaagaggaacttcgcggatgtattcattggtgccaaccca
ttagccgtggacctgctggagaagatgctggttttggacacggatacgcggatcacggcc
tcagaggcgctggcccacccgtacttcgcgcagtaccacgacccggaagatgagcctgag
gccgagccttacgaccagagcttcgagagccgagagctggacattgaggagtggaaaaga
ctgacgtatgaagaagtcctgagttttgagccgcccgtgtttgacggagatgagatggag
tcatga

DBGET integrated database retrieval system