KEGG   Pangasianodon hypophthalmus (striped catfish): 113539676Help
Entry
113539676         CDS       T05759                                 

Gene name
mapkapk2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
phyp04218  Cellular senescence
phyp04370  VEGF signaling pathway
phyp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113539676 (mapkapk2)
   04370 VEGF signaling pathway
    113539676 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113539676 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113539676 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113539676 (mapkapk2)
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113539676 (mapkapk2)
Protein kinases [BR:phyp01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   113539676 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 113539676
NCBI-ProteinID: XP_026791446
Position
Unknown
AA seq 386 aa AA seqDB search
MFPNSQNQVVFPNQQQQQQQQQQQALQHLQFHPKPALQIKKNAITDDYKVTNQVLGLGIN
GKVLEIVQKKNGEKYALKMLQDCPKARREVELHWRASPCAHIVRIIDVYENLHQGRKCLL
IVMECMDGGELFSRIQDRGDQAFTEREASDIMKSIGEAILFLHSINIAHRDVKPENLLYT
SKRPNAVLKLTDFGFAKETTTLNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYI
LLCGYPPFYSNHGLAISPGMKRRIRMGQYEFPNPEWSEVSEEAKQLIKRLLKTEPSMRMT
ISEFMYHPWINQSMEVPQTPLHTSRVLKEEKDVWEEVKEEMTSALATMRVDYEQIKIKTI
EDSSNPLLMKRRKKANMAAENQTPNS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaactcccagaaccaggtggtgttccccaaccagcaacagcagcagcagcag
caacaacagcaagctttacagcacctccagttccaccccaagcccgcgcttcagataaag
aaaaacgccataacagacgactacaaggtcactaaccaggtcctgggtttgggtatcaat
gggaaggtgttggaaatcgttcagaagaagaacggggagaagtacgcgctgaagatgctg
caggactgtcccaaagccaggcgtgaggtagagttgcactggcgagcatcaccttgtgct
cacatcgtgcgtatcattgatgtatatgaaaacctgcaccagggccgcaagtgcttactc
atcgtcatggagtgtatggatggtggggagcttttcagtcgaattcaggaccgaggggac
caggcattcactgagagagaagcttcagatatcatgaagagtattggagaagccatcctg
tttctgcactctatcaatatagcacacagagacgtcaagccagaaaacctcttgtatacc
tcaaaacgacccaacgccgtcctcaaactcacagactttggatttgcaaaagagacgacc
acactgaattcgctggccaccccatgttacactccctattatgttgcccctgaagttctt
ggtccagaaaaatatgacaaatcctgtgatatgtggtctttgggtgtcatcatgtatatt
ctgctctgtggctacccacctttctattccaatcatggtctggccatatcacctgggatg
aagaggaggatccgcatgggacagtatgagtttcccaatcctgaatggtccgaagtctca
gaagaagccaaacaactcatcaagaggttgctaaagacagagccctcaatgaggatgacc
atatcagagtttatgtaccatccctggatcaatcagtcgatggaagtgccacagaccccc
ttgcacaccagccgtgtactaaaagaagagaaagatgtctgggaggaagtcaaggaggaa
atgactagtgccttggccaccatgagagtggactacgagcagatcaaaatcaagaccatt
gaggactcctccaatccactgctgatgaagaggagaaagaaagcgaacatggctgctgaa
aatcagacacccaacagctga

DBGET integrated database retrieval system