KEGG   Pangasianodon hypophthalmus (striped catfish): 113540131Help
Entry
113540131         CDS       T05759                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-2-like isoform X1
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04060  Cytokine-cytokine receptor interaction
phyp04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113540131
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113540131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phyp01001]
    113540131
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     113540131
Protein kinases [BR:phyp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   113540131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 EcKinase
Motif
Other DBs
NCBI-GeneID: 113540131
NCBI-ProteinID: XP_026792184
Position
Unknown
AA seq 380 aa AA seqDB search
MNITWYQEANQNQYNHSQYTSDHLSANIFIIPAIILAIAVLFIIALTWKIVCKCWWPATP
PNTCGIPKGSDTDLGNLALQKVIGYGHFGCVWQGTFQGSSVAVKVFSKKLKWEFSKEKDV
YILPLMKHPGIVQFLTAGRMGKEYVLVLELATEGSLNAFLSRTVCDWRHAVKLAQTLSEG
LAYLHTDLQNHGVYKPVVAHGDFSSNNVLVRSDGSCALCDFGCSTILQNFRICQTLEVQR
DIAKQGTFQRGTLRYMAPEILDGCVNPSSGHSFLQADVYSLGLLLWELLMRCSDLFKDSP
IPEHMLPYEIELGHSPTHQDLVTFVSEKGLRPTIPHLWGNISQGWSLREILEDCWDHDED
ARLTAQCAANRLASLPSELY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacctggtatcaggaagccaatcaaaatcaatacaaccattctcagtacacc
tcagatcacctgagtgccaacatcttcattattcctgctataattctggccattgcagtt
ttattcataattgcactgacatggaaaatagtttgtaaatgctggtggcctgcaacacct
ccaaacacttgtggcatcccgaaggggtctgacactgacctgggtaacttggcattgcaa
aaggtaataggttatggccattttggatgtgtttggcagggaaccttccaaggatcatcg
gtggctgtgaaagtgttttctaaaaaactaaaatgggaattcagtaaagagaaagatgtg
tacattctacctttaatgaagcatcctgggattgtacaatttcttacagcaggaagaatg
ggaaaagagtatgtgcttgttttggaactagcgaccgaaggctctctgaatgcatttctg
tcaagaaccgtgtgtgactggagacatgctgtaaaactagctcaaaccttatcagaagga
ctggcctatctccacactgacttacaaaaccatggagtctataaacccgtggtagctcat
ggtgatttcagcagcaataatgttctggtgagatctgatggctcttgtgctctgtgtgac
tttggttgctccacaatcctacaaaactttcggatctgccaaacactggaggttcagcgt
gacatagcaaagcagggcacatttcagaggggcacactgcgctacatggcaccagagatc
ttggatggctgtgttaatccaagcagtggccactcttttctgcaggcagatgtgtattcc
ttaggactgcttctgtgggagctgctaatgcgttgctctgatctcttcaaagattctcct
atcccagaacacatgttgccttatgaaatagaactgggacacagtccaacccatcaggat
cttgttacttttgtgtcagagaaaggactgcgaccaaccataccccacctgtggggtaat
atatctcagggatggtctctccgtgagatccttgaagattgctgggatcatgatgaggat
gcaagactgacagcacaatgtgctgccaacagattggcttctttaccctctgaactatac
tag

DBGET integrated database retrieval system