KEGG   Pangasianodon hypophthalmus (striped catfish): 113540340
Entry
113540340         CDS       T05759                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phyp03036]
    113540340
Chromosome and associated proteins [BR:phyp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    113540340
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 113540340
NCBI-ProteinID: XP_026792583
Position
Unknown
AA seq 388 aa
MEGVCARKLPAGDLFHAAVSGDPEWLGLSLERVQSPGQQHNKQGLTVLHVAAQHGQLNCL
KLLLESCIVDVNASCLRGWRPLHMALSPESKPNSYCCLTYLLEHGAEPNVSTDEGLTPLH
MAAAEGLRECVETLVRVGADTHARDSRGHTPLELACLWGHRVVARILKNAMWHRDKKRDM
QKRQELQNLKQNMIRMHRKAEGMQKLAREAINKQKVSEWAESKGLPCLRSPTTGLWILKH
HCCHSAKPVTKHHAAESREMWNISPNPSRPPPANISRSSTVRIGVHPEEAVDEPDLHQSV
TLHSSGNGHVHCTASWDDIPQPMPDLPLDVIQKGLFPSEFPSRISGPLQLQCSSVLDLPH
RGGIHGTEASPWTEVAMHLAEELQPGRY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggagggcgtgtgcgcgcgaaagctcccagccggagacttgtttcatgccgcagtgtct
ggagatcctgagtggctgggtttgagtctggagagagtgcagtcaccaggtcagcagcac
aataaacagggtcttacagtgctccacgtggctgctcaacacggtcagctaaattgcttg
aagctgcttctggaatcttgtattgtggatgtgaacgcaagctgtctgcgtggctggaga
ccgttacacatggcgctgagcccagagagcaagccaaactcttactgctgcctcacatat
ctgctggaacatggagcagagcccaatgtttccacagatgaaggactgaccccactgcac
atggccgcagctgaaggcctgagagagtgtgttgaaacgttggttagggttggagcagac
actcacgcacgtgatagccgaggacacacacccctcgaactcgcttgcctgtggggtcac
agggttgttgccaggattcttaaaaacgcaatgtggcatagagataagaagagagacatg
cagaaacgccaagaactgcagaatctcaaacagaacatgatcaggatgcacaggaaagca
gagggaatgcagaagttagccagagaggccattaacaagcagaaggtatccgagtgggct
gaaagcaagggtcttccctgtctcaggtctccgacaacgggcttgtggatattaaagcat
cactgctgccattctgccaagcctgtcacaaaacaccatgcagctgaatcaagagaaatg
tggaacatctcacccaacccatcaagacctcctccagcaaacatcagcagatctagcaca
gtgagaatcggtgtccatccagaggaagcagtagacgagcctgatctgcaccagagtgtg
actctgcatagttctggaaatgggcacgtccattgcactgcgtcatgggatgatattcca
cagccgatgcctgacctgccactggatgtcattcagaaaggtttgtttccatctgaattc
ccctcgcgaatttctggtccacttcagctccagtgcagcagcgtgctggatttgcctcat
cgaggaggtattcatggaactgaagcttctccctggaccgaagtggcaatgcatctggct
gaggagctccagcctggccgttactga

DBGET integrated database retrieval system