KEGG   Pangasianodon hypophthalmus (striped catfish): 113540864Help
Entry
113540864         CDS       T05759                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113540864
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:phyp04030]
    113540864
G protein-coupled receptors [BR:phyp04030]
 Rhodopsin family
  Lipid
   Leukotriene
    113540864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 113540864
NCBI-ProteinID: XP_026793287
Position
Unknown
AA seq 341 aa AA seqDB search
MNSSSYSSYNSTVSGDEWATAGGAVACVILSVCFVVGTPGNLLVMWTIMRHVKQRSHTLL
LIMHLAVADMLVVVTLPLWIYSLAWSWVFGEAACKAMVYVIYACMYASVFLITIMSVERY
LSVRYPFKMLHWKNSNAMNLILAGGWTLALLLGLPAFLTQSLNESMDGVQHCFFSEFGSV
ALEVFCACLETLIGFVIPFLTLAVCYVQVAAQLRQMHKKNKQKSAFLVSGVVVAFALCWL
PHHVMNVINVAQLLGAHSEKLAEVSEAAVFISGALTFISSSVNPMLYAFAARNFQGSLRK
SAMAKLFQEIASYTVQLRGAELQTSDCLDQDTLKKESAADV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctcgtcttactccagctataacagcacagtctcgggggatgaatgggccact
gcggggggagctgtggcgtgcgtgatcctgtctgtgtgctttgtggtggggactccaggg
aacctgctggtcatgtggaccatcatgaggcacgtgaagcagcgctctcatactctgctg
ctcatcatgcacctggctgttgctgacatgctggtagttgtgaccctgcctctgtggatc
tactcgctggcttggtcctgggtttttggtgaggctgcgtgcaaggccatggtgtatgtc
atctatgcctgcatgtatgccagtgtttttctgatcactattatgagtgtggagcgctat
ttgtctgtgaggtaccctttcaagatgctgcactggaaaaacagcaatgctatgaatcta
attctggctggggggtggaccctggcactcctgctaggactgccagcatttttgacccag
tctcttaatgagagcatggatggtgttcagcactgcttcttctcagagtttggttcagtg
gccctggaggtcttttgtgcatgtttggagacactgattggctttgttatcccatttctc
accctggctgtgtgctatgtccaggtggcagctcaacttcgccagatgcacaaaaagaat
aaacagaaatccgccttcctcgtcagtggcgtggtggtggccttcgctctgtgctggctg
ccccatcatgttatgaatgtcattaatgtagcacagctgctcggagcacactcagaaaaa
ctggcagaagtctcagaagcagcagtgttcatctctggagcgctgacattcattagcagc
tcagtgaacccaatgctttatgcttttgctgccagaaacttccagggtagtctgaggaag
tcagcgatggccaagctgttccaggaaattgcttcatatactgtccagttaagaggggca
gagctccaaacctctgactgtttggaccaggacacactcaaaaaagagtctgcagcagat
gtctaa

DBGET integrated database retrieval system