KEGG   Pangasianodon hypophthalmus (striped catfish): 113540997Help
Entry
113540997         CDS       T05759                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00232  Caffeine metabolism
phyp00983  Drug metabolism - other enzymes
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    113540997
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    113540997
Enzymes [BR:phyp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     113540997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 113540997
NCBI-ProteinID: XP_026793540
Position
Unknown
AA seq 290 aa AA seqDB search
MDLQEYFKKIGFSGVYEKPDLATLCTVHKLHVMSIPFENLSIHCGEWNTMDLQIVYDKIV
RNRRGGWCCENNQLFSWVLREMGYKYTTLGCKVFNTLKNDFNPFNSHLINMVEIEGKPYI
ADVSFGVSCQIWHPLEMIAGKDQEQPAGIFRLLNDGETWTLEKTGRKPLVQNKAFTNSSL
IDKRVTKTMYSFLLIPRGIDHFLNTSEYLQTSPESLFTQKSICSIQTSTGFRALIGWTYS
EVTFNPEEDTDIIEMRDVAESEIDIILKEKFNIFLVNKLTPINNKAAYKM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaggaatacttcaaaaagatcgggttcagcggggtgtacgagaaacccgat
ctggccacgctctgcactgtgcacaagctgcatgtgatgagcatcccctttgagaacctc
agcatccactgtggagagtggaacaccatggacctgcagatcgtctatgacaagattgtg
agaaaccggcgtggaggatggtgctgtgaaaacaatcagctcttctcctgggtgctgagg
gagatgggctacaaatacaccacactgggctgcaaagtcttcaacacgctcaaaaatgac
tttaaccccttcaattcacaccttataaacatggtggagatcgaaggcaagccgtatatc
gctgatgtgagttttggagtgtcatgccaaatctggcatccgttagaaatgatcgcggga
aaagatcaagagcagccagcaggaatcttccgcctactgaacgatggtgagacttggacg
ttggagaagactggaaggaagccactggtccagaataaagccttcaccaattccagcctc
attgacaagcgtgtcactaagacaatgtactcttttctgttaataccacgtgggattgac
cattttctgaacacaagcgagtatctgcagaccagccccgagtctctgttcacccagaaa
tccatttgctccatccagacctccactggattcagagctctgattggttggacctacagt
gaagtcacatttaaccctgaggaagacacagacatcatcgagatgagagatgtagctgaa
agtgagatagatattatactcaaggagaagtttaatatctttttagttaataaactgaca
ccgattaacaacaaagctgcatataaaatgtag

DBGET integrated database retrieval system