KEGG   Pangasianodon hypophthalmus (striped catfish): 113541012Help
Entry
113541012         CDS       T05759                                 

Gene name
cars
Definition
(RefSeq) cysteine--tRNA ligase, cytoplasmic isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113541012 (cars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phyp01007]
    113541012 (cars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phyp03016]
    113541012 (cars)
Enzymes [BR:phyp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     113541012 (cars)
Amino acid related enzymes [BR:phyp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   113541012 (cars)
Transfer RNA biogenesis [BR:phyp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    113541012 (cars)
 Prokaryotic Type
    113541012 (cars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 113541012
NCBI-ProteinID: XP_026793564
Position
Unknown
AA seq 822 aa AA seqDB search
MAGDQAFDYGFLLRISEDGRRAQALNEYLSSRSYLAGYGPSQADTDVFTLFHGSPPSSQY
VHALRWYRHIATLQPRTDGQASDSTKGKRVQPPWSPPDGTELPKLRLYNSLTRTKELFVP
QHGKKVLWYCCGPTVYDASHMGHARSYISFDILRRILMDYFKYDVFYCMNITDIDDKIIK
RARQNHLLEQYRAKKPKASQILQDVLTAREPFKVKLAETTDPDKKQMLERLDAAVMAALT
PLHGSMKSGAEDAAVQSQAEVLLEEAKDLLSDWLDSQFGSQVTENSIFSLLPKYWEGEYH
KDMDALNVLPPDVLTRVSEYVPEIVEFVKKIVDNGYGYESNGSVYFDTAKFDASSGHSYA
KLVPEAVGDQKALQEGEGDLSISADRLSEKRSQNDFALWKTSKPGEPSWESPWGKGRPGW
HIECSAMAGSILGSSMDIHGGGFDLRFPHHDNELAQSEAYFDNDHWVRYFLHTGHLTIAG
CKMSKSLKNFITIKDALAKHTARQLRLAFLMHSWKDTLDYSCNTMESAIQYEKFMNEFFL
NVKDILRTPTDITGQFEKWEAEEIDLNKSFYEKKEGVHEALCDNIDTRTALEEMRALVGQ
SNTYIAARKSAKLLPNRMLLQSIAHYLTDMFKTFGAIEGTEPIGFPVGRNDQNVDLESTV
MPYLKVLSDFREGVRKIAREQKVTEVLQLCDAVRDDILPELGVRLEDHEGLRTVVKLVDR
ETLLKEREEKKKLEEEKRKKKEEAARKKQEQEMAKLAKMKIPPSEMFRSETDKYSSFDDT
GFPTHDAEGKELSKGQSKKLRKLYEAQEKLYTEYLQSTQNGS
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaccaagcctttgattatggcttcttactgcgcataagcgaggacggccgc
agggcccaggctctgaacgagtacctgagcagccgcagttacctggcaggctacgggccc
tcgcaggcggacacagacgtattcacgctttttcatggttcgcctccttcatcgcagtat
gtgcacgctctgcgctggtacaggcacatagccacactgcagcctcgaaccgacggccag
gcctcagactccacaaagggaaagagggtgcagcctccctggtctccaccggatggaact
gaactcccaaagcttagactttacaacagcctgacccggaccaaggagctgtttgtacct
cagcatgggaaaaaggttttgtggtactgctgtggccccaccgtctatgatgcttcccac
atgggtcatgccagatcctacatttctttcgacatcctaagaagaatactgatggactat
ttcaaatatgacgtcttctactgcatgaacatcaccgacattgacgacaaaatcattaaa
cgagccagacagaatcacctgctggagcagtacagagccaaaaagcccaaagcctcccag
atcctccaggacgtcttaaccgctagagagccctttaaagtcaagcttgcagaaaccaca
gaccctgataagaagcagatgttggagaggctggatgcagcagtgatggctgcgctgact
ccattacatgggtcgatgaagagcggagctgaggatgctgccgttcagagccaagctgag
gttttactggaagaagccaaggaccttttatctgattggttggattcccagtttggcagc
caagtaacagaaaactcaatattctccctcttaccgaaatactgggagggagagtatcac
aaagacatggatgccctcaatgttcttccacctgatgtcctcacacgggtcagtgaatat
gttccagagattgtggagtttgtaaagaaaatagtagacaatggatacggttatgagtct
aacggctcggtgtatttcgacactgcaaagtttgatgctagttcaggacattcgtatgct
aaactggtgccagaagcagtgggtgaccagaaggctctgcaggagggagaaggagacttg
agtatctcagcagaccggctgagtgagaagcgttcacagaatgactttgccctttggaag
acctctaaacctggagaaccgtcctgggagtctccatgggggaaggggcgacctggttgg
catatcgagtgttcagccatggctggctccatattaggttcatctatggacattcatgga
ggaggatttgacctgcgtttccctcatcatgacaatgaactggcacagtccgaggcctac
tttgacaatgaccactgggtgcgctatttcttgcacacgggccaccttaccatcgccggc
tgcaagatgtccaagtctctgaagaactttatcaccattaaagatgcccttgcgaaacac
acagcaaggcagctgcgcctggccttcctcatgcactcgtggaaggacacactggattac
tcctgtaacaccatggagtctgccattcagtacgagaagttcatgaatgagttcttcctg
aatgtgaaagatatcctgaggactcccactgatatcacaggtcaatttgagaaatgggag
gcggaggagatcgacctgaacaaaagcttctacgagaagaaagaaggcgttcacgaggct
ctgtgtgacaatatcgacactcgtacagctctggaggagatgagggctctggtgggtcag
agcaatacttacattgctgccagaaagagtgccaaactcctgccgaaccgcatgctgctc
cagagcatcgctcactacctcaccgacatgttcaagacttttggggcaatcgagggaaca
gaaccaattggatttcctgttggaagaaatgaccaaaatgttgatctggagagtacagtc
atgccctatttaaaggtgctctcagacttcagggaaggtgtcagaaaaattgcaagggaa
caaaaagtgacagaagtactgcagctgtgtgacgcagtcagagatgacatcctgccggag
cttggagtccgtttagaagatcatgaaggactccgcactgtggtgaagttagtggacaga
gagactctactcaaggagagggaggagaagaagaagctggaggaggagaagagaaagaag
aaagaggaggcagccagaaagaaacaggaacaagagatggctaaactggcaaagatgaag
attccacctagtgagatgttccgctcagaaacggacaagtactccagctttgatgacacg
ggtttccctacacatgatgcagaagggaaggagcttagcaagggacagagcaaaaagctt
cgcaagctttacgaagctcaggaaaagctgtacactgagtacctccagtcaacccagaac
ggaagctga

DBGET integrated database retrieval system