KEGG   Pangasianodon hypophthalmus (striped catfish): 113541634
Entry
113541634         CDS       T05759                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp00240  Pyrimidine metabolism
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113541634
   00240 Pyrimidine metabolism
    113541634
Enzymes [BR:phyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     113541634
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17 AAA_28
Other DBs
NCBI-GeneID: 113541634
NCBI-ProteinID: XP_026794537
Position
Unknown
AA seq 264 aa
MATPPKRMCSSPDFNSSFEKRVKKISIEGNIAAGKSTFVRLLERETEEWEVIPEPIGKWC
NVQTTENEYEELTTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRAQLQPASAKLQQA
EHPVQFYERSVYSDRYVFASNLFESGDLNETEFAIYQDFHSWLLSQFESDLELDAIVYLR
ADPERCMQRLKFRGREEEQGIPLEYLEKLHYKHECWLYNRTTQLDFEYLKDLPILVLDVN
DDFKNDRIKQQEVVDKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgactcctccgaagagaatgtgctccagtcctgactttaacagcagctttgagaag
agagttaagaagatatccattgaaggaaacattgctgcaggcaagtcgacctttgtgcgg
ttgttggaaagagaaacagaggaatgggaagtgatccctgagcccattgggaagtggtgc
aatgttcagactacggagaacgagtatgaggagctgaccacatcccagaagagtggaggc
aacctgctgcagatgttgtatgacaagcccagccgctggtcctacaccttccagacttac
gcttgcctgagccgtgttcgtgcccagcttcagcctgcttctgccaagctgcaacaggct
gagcatccagtccagttctatgagcgctcggtctacagtgacagatatgtttttgcttca
aacctattcgagtctggagacttaaatgagactgagtttgccatctaccaagactttcat
agctggcttctctctcagtttgagtctgacctcgagcttgatgccatagtctatttgcgg
gccgatcctgagaggtgtatgcagcgtcttaaattccgaggtcgtgaggaagagcagggc
attcctctggagtacttggagaaacttcactataaacatgagtgttggctctataacaga
actacacaacttgatttcgagtacttgaaggatctccctattctggtgctggatgttaac
gacgacttcaagaatgacagaattaagcagcaggaagtggttgacaaggtgaaggaattt
ctgtctacgctctaa

DBGET integrated database retrieval system