KEGG   Pangasianodon hypophthalmus (striped catfish): 113542654
Entry
113542654         CDS       T05759                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phyp01002]
    113542654
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     113542654
Peptidases and inhibitors [BR:phyp01002]
 Metallo peptidases
  Family M1
   113542654
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 113542654
NCBI-ProteinID: XP_026796114
Position
Unknown
AA seq 921 aa
MALLVLLLCLCSVSSSWTAVTQAREETESSFPTSTSGETFPWNKMRLPETVSPFHYTLLI
HPNLTSLDFTGRVKIRVDVLQDTHTIVLHSKELNISRAVLRSLAEGQSQALRVLEYPAYQ
QIALISEHMVLRRGSVYIIELEFAAKLSESFHGLYKSTYRSSDGEERVLASTQFEPTSAR
AAFPCFDEPAFKANFSIHIRRESTHIAISNMPKLRTLALPGGLFEDQFDETVKMSTYLVA
FIVCDFLSISKYTQHGVEISVYAVPEKIKQAEFALDAAVKLLDFYDDYFDIPYPLPKQDL
AAIPDFQAGAMENWGLTTYRETALLFDPHKSSASDKLGITMIIAHELAHQWFGNLVTMQW
WNDLWLKEGFAKFMEFVSVNITNPELQVEDYFLGKCFDAMEVDCLSSSHPVSIPVENPAQ
IQEMFDDVSYEKGACILHMLREFLSPDVFKMGIVAYLKRYSYQNTVNTHLWESLTAKQHS
EDEVDVRAMMETWTLQEGFPLITVEVRGREVRLSQERYLKGEDSSQTSGFLWHVPLTYVT
SSSSTVHRFLLKTKTDVLYLPEEVDWIKFNVDMSGYYIVHYEGSGWDDLITLLNHNHTAL
SSNDRASLINNAFQLVSVGKLPLDKALDLSLYLSRETEIMPVTQGFSELMPLYKLMERRD
TLEVLENQMKSYIVHLFHKLIDQQVWSDDGSVSQRMLRSYLLLFACVRDHPPCISTASEL
FNKWKESDGKMSLPNDVSLAVFAVGARTEEGWNFLFEKYRETIYTSLKSRIKSALSITPL
AHKLKWMMEQSLEGSVMKTQDLPYVVVAISRNSKGYKHTWDFLRANWDSLVKKFDLGSHS
IAHMVTGVTSQYSTREKLEEIRSFFGSLSAETGAELRCIQQALENVEENIRWMDKNLPLL
QAWLDKNHLEPQKRYDLHTDL
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggccctcctggtgctcctcctgtgtttgtgctccgtgtcatcgtcttggactgcagtg
acgcaagccagagaagaaaccgagtcctccttcccaacatcgaccagcggagagacgttc
ccctggaacaagatgaggcttccagagaccgtctctccgtttcattacactctcctcatc
caccccaacctcaccagcctcgacttcacagggagagtgaagatccgagtggacgtcctc
caggacacacacaccatcgtcctccacagcaaggagctcaacatctccagagccgttctc
cgcagtttggctgaaggtcagagccaggctctcagggtgctggagtatccggcctaccag
cagatcgctctcatcagtgaacacatggtgctgaggagaggaagtgtgtacatcatcgag
ctggagtttgcagccaaactgtccgagagcttccacggtttatataaaagcacgtaccgc
tccagtgatggagaggaacgggtgctggcctccacacagtttgagccgacgagcgcgcga
gcagctttcccctgtttcgatgaacctgcattcaaagccaacttctctattcacattcgc
cgtgagagcacacacatcgccatctccaacatgcccaagctgaggacgctggctctccca
ggcggtctgtttgaggatcagtttgacgagactgtgaagatgagtacatacctggtggcc
ttcatcgtgtgtgacttcctgtctataagcaaatacactcagcatggagttgagatctcg
gtgtacgctgtacctgagaagataaagcaggccgagttcgctctggacgctgcagtgaag
ctcctggacttctacgatgattactttgatattccctaccctctgcctaaacaagatctg
gctgcaattccggacttccaggcaggtgctatggagaactggggtttgaccacgtacagg
gagacggctctgttgtttgacccccacaagtcctcagcctccgacaagctgggcatcacc
atgatcatcgcacacgagctcgctcatcagtggttcggtaatctggtgacgatgcagtgg
tggaatgatctctggctgaaggagggcttcgctaagttcatggagtttgtgtctgtgaac
atcaccaaccctgagctgcaagtggaggactatttccttgggaagtgcttcgatgcaatg
gaggtagactgtttaagctcctctcaccccgtgtccatccccgtggagaacccggctcag
atacaggagatgttcgatgacgtgtcttatgagaagggtgcatgtatcctgcacatgctg
agggagttcctgagccctgacgtatttaagatggggattgttgcctacctgaaacgctac
agctaccagaacaccgtcaacacacacctgtgggagagtctgaccgctaagcagcactct
gaagacgaggtggacgtcagggcgatgatggagacgtggaccctgcaggaaggcttcccg
ctcatcacggtggaggtcagaggtcgtgaagtgcgcctgagtcaggagcgatacctgaag
ggcgaggactcgtcccaaacctctggatttctgtggcatgttccgctgacctatgtcacc
agcagctcaagcacagtgcatcgcttccttctgaagactaagacagatgtgctgtacctg
cccgaggaagtggactggatcaagtttaacgtggacatgagcggatattacatcgtccat
tacgagggctcgggctgggacgacctcatcactttgctcaatcacaaccacacggctctg
agcagcaatgatcgggccagcctcatcaataatgccttccagttggtcagcgtgggtaag
ctgccactggacaaagctctggacctgtcgctatatctgagtcgggagactgagatcatg
cctgtgacgcagggcttcagtgagctcatgccactttacaagttgatggagaggagggac
acactggaggtgctggagaaccagatgaagagctacatcgtgcacctgttccacaagctc
attgatcagcaggtgtggagtgatgatggatcggtgtctcagagaatgctgcgcagttat
ctgctcctgttcgcgtgtgtgagggatcacccgccctgcatctcgaccgccagcgagctc
ttcaacaagtggaaggagtctgatggcaaaatgagtcttcctaacgatgtgagtctggca
gtatttgcggtcggggctcgcaccgaggaaggatggaacttcctgtttgagaagtaccgt
gaaacaatctacacttctctgaagagccggatcaagtcggccctctccatcactcctctc
gctcacaaactgaaatggatgatggagcagagtttggagggttcggtgatgaagacacag
gacctgccgtatgtcgtggtggccatcagtaggaactctaaaggttataaacacacctgg
gacttcctgagggcaaactgggactctctggtgaagaagttcgacctcgggtcccactcc
atagcgcacatggtgacgggcgtgaccagccagtactccaccagagagaagctggaggag
attcgcagcttcttcggttctctgagtgccgagacgggcgctgagctgaggtgcatccag
caggcgctggagaatgtggaggagaacatccgctggatggacaagaacctgcccctgctg
caggcctggctggataagaaccatctggagccacagaagcgctatgacttgcacactgac
ctgtga

DBGET integrated database retrieval system