KEGG   Pangasianodon hypophthalmus (striped catfish): 113542985Help
Entry
113542985         CDS       T05759                                 

Definition
(RefSeq) cAMP-responsive element modulator-like isoform X1
  KO
K09052  cAMP response element modulator
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113542985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113542985
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    113542985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 Rh5 TPR_MLP1_2 Nnf1
Motif
Other DBs
NCBI-GeneID: 113542985
NCBI-ProteinID: XP_026796659
Position
Unknown
AA seq 114 aa AA seqDB search
MHFFCLCVWVGGHIAATGDMPACHIRSSSSGLPQSMVMAASPGEIHSPQQQAEEATRKRE
VRLMKNRQAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDIYCHKPE
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcattttttctgtttgtgtgtctgggtgggtggtcatatagccgctacaggagacatg
cctgcatgtcacatccggtcctcatcgtcagggcttccacaaagtatggtcatggctgca
tcaccgggggaaatccacagtccgcagcaacaagcagaggaggctacacgcaaacgagag
gttcgcctgatgaagaaccggcaggcagcacgagagtgccgtcggaagaagaaagaatat
gtgaagtgtctggagaatcgcgttgctgtgctggaaaaccagaacaaaacactaatagag
gaactcaaagctctcaaagacatttactgccacaagcctgagtaa

DBGET integrated database retrieval system