KEGG   Pangasianodon hypophthalmus (striped catfish): 113543748Help
Entry
113543748         CDS       T05759                                 

Gene name
nsun2
Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phyp03016]
    113543748 (nsun2)
Enzymes [BR:phyp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     113543748 (nsun2)
Transfer RNA biogenesis [BR:phyp03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    113543748 (nsun2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F
Motif
Other DBs
NCBI-GeneID: 113543748
NCBI-ProteinID: XP_026797973
Position
Unknown
AA seq 773 aa AA seqDB search
MGKRNRNRQHYKDGRPEGKRSRDDAGWGAGYAEIIKENKLFEQYYRELKIVPEGEFEEFM
EAMREPLPATIRITGYKSHAKEILHTLKEKYFKEIQDLEIDGQKFEAPQALSWYPDELAW
HTNMSRKILRKSPLLEKFHQFLVNETESGNISRQEAVSMIPPLLLKIEPHHKILDMCAAP
GSKTAQLIEMLHSDMDVPFPEGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDASCIP
RLQVESNGKKDILFYDRVLCDVPCREFVYIGVFVFSIPASCCCVCVCVSLYSSLQLRIAV
RGVEQLAVGGRMVYSTCSLNPIEDEAVIASLLEKSEGALELADASTDLPGLKYMPGITSW
KVMTREGHWYSDWSEVPSSRHTQIRPTMFPPTDPEKLKSMHLERCMRILPHHQNTGGFFV
AVLVKKAPMPWNRRYPKLRNKEATSTTSEEVQAEEGEAETAAEGDAVLEDTPETEAKKDG
VCGPPPSKKMKLFGFKEDPFVFLTEDDPVFPPIQTFYDLSPDFPKLNVLTRTHEGKKRHL
YMVSKELRNVLLNNSERMKVINTGVKVWSRNNDGEQFGCAFRLAQEXXXXLCPYIRARVI
TISMEDVKVLLTEENPFLSRLGDDAHAQAKKLEMGSIVLRYQPDPNDPSAPQCQIDLCGW
RGKTSIRAFVARNERFHYLRMVGVEVFHNKQGKKEGGAAEAREGGAAEAREGGAAEAREG
GAAEAQEGGAIEEVVTGQEEGQEEGGMQKENSDMEQNGSSESKSNGAEEASST
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaagaaacaggaacagacagcattacaaagatggacgaccggaaggaaagagg
agcagagatgatgctggctggggtgcgggctacgctgaaattatcaaggagaacaagctg
tttgaacagtactaccgtgagctgaagatcgttcccgagggagagtttgaggagtttatg
gaggctatgagagagccactgcctgccaccatccgcatcaccggctacaaaagtcatgcc
aaagagatcctacataccctgaaagagaaatacttcaaagaaatacaggacctggagatc
gatggacaaaagtttgaagcccctcaggctctaagctggtaccctgatgaactggcttgg
cacaccaacatgagcaggaagatcttgcgcaagtctccacttctggagaagttccatcag
tttttagtgaacgagaccgaatccggaaatatcagccgacaggaggcggtcagtatgatt
cctcctctactgctgaaaatcgaacctcatcacaagattttggatatgtgtgctgcccca
ggatcaaagactgctcagcttatagagatgctccattctgatatggatgtgccctttcct
gagggctttgtaatcgctaacgatgtggataataagcgctgttacctgctggtgcaccag
gctaagaggctgaacagtccgtgtatcatggtggtgaaccacgatgcctcctgcatccct
cgcctgcaagtggagagcaacggaaagaaggacatcctgttctatgacagagtgctgtgc
gatgtcccctgcagggagtttgtatatattggtgtctttgtattctctataccagccagc
tgttgttgtgtgtgtgtttgtgtgtcactgtattctagcctgcagttgaggattgctgtg
cgtggcgtggagcagctggctgttggtgggcggatggtttactccacctgctctctgaac
cccatcgaggatgaagcggtgatcgcctccctgctggagaagagtgaaggtgccctcgag
ctggctgatgcctctactgacctgcctggtctaaagtacatgcctgggatcacatcctgg
aaggtgatgaccagagagggtcactggtactctgattggtccgaagttccctccagtcgt
cacactcagatcagacccaccatgttccccccaactgaccctgagaagctgaagagcatg
catctggagagatgtatgaggatactgccgcatcaccagaacaccggtggcttcttcgtg
gctgtgctggtgaagaaggcgcccatgccgtggaatcggcgctatccaaaacttcggaat
aaagaggccaccagcactaccagtgaggaagtgcaggctgaggagggagaggcagagaca
gcggccgagggagacgccgttctggaagacactccagagacagaggccaagaaagatgga
gtgtgtggccccccgccttcaaagaagatgaagctcttcggattcaaagaagatcccttt
gtgtttctgacagaggatgacccagtcttccctcccatccaaacattctacgacctctct
ccagacttccccaagctgaacgtcttgaccaggacacacgaggggaagaaaaggcacttg
tacatggtgtccaaggagctccgcaatgtcctgctcaacaacagtgagagaatgaaagtg
atcaacacgggagtgaaagtgtggtcgaggaataatgatggagaacagttcggctgtgcc
ttcagactggcccaggagnnnnnnnnnnntctgtgtccctacatcagagcgcgtgtcatc
accattagcatggaggacgtgaaggttcttttaaccgaggagaatcctttcctcagcagg
ctgggtgatgacgctcacgcccaggccaagaaactcgaaatgggcagcatcgttctaaga
taccaacctgatccaaatgatcccagtgctcctcagtgccaaatagatctgtgtggttgg
cgaggaaagacgtccatcagggctttcgtggcccggaacgagcgtttccactacctgcgc
atggtgggtgtggaggtcttccataacaagcagggcaagaaggaaggaggtgcagcagaa
gctcgggaaggaggtgcagcagaagctcgggaaggaggtgcagcagaagctcgggaagga
ggtgcagcagaagctcaggaaggaggtgcaatagaggaggtggtgacaggacaagaagaa
ggacaagaagaaggaggcatgcagaaagagaactcggacatggaacagaacgggtcctca
gaatccaaaagtaatggagcggaggaagcaagcagcacttga

DBGET integrated database retrieval system