KEGG   Pangasianodon hypophthalmus (striped catfish): 113544028Help
Entry
113544028         CDS       T05759                                 

Definition
(RefSeq) glutathione hydrolase 1 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00430  Taurine and hypotaurine metabolism
phyp00480  Glutathione metabolism
phyp00590  Arachidonic acid metabolism
phyp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113544028
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    113544028
   00480 Glutathione metabolism
    113544028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phyp01002]
    113544028
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:phyp04090]
    113544028
Enzymes [BR:phyp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     113544028
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     113544028
    3.4.19.14  leukotriene-C4 hydrolase
     113544028
Peptidases and inhibitors [BR:phyp01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   113544028
CD molecules [BR:phyp04090]
 Proteins
  113544028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept DUF1959
Motif
Other DBs
NCBI-GeneID: 113544028
NCBI-ProteinID: XP_026798410
Position
Unknown
AA seq 574 aa AA seqDB search
MVQKSVVVGLAVLLIAAVGTFLGVFFGYRGNLSPVVIERSYQHAAVAADAGPCSEVGRDI
LLQGGSAVDAAIAGLLCVGLMNAHSMGIGGGLFLNIYNADTGRVETIDARETAPANSSRD
MFGNSTDLSQKGGLSIAVPGEIRGYELAHKRHGKLAWKELFMPSIKLAKNGFPVGKALAG
AIANNRNTILTDEELCSVFCNKNGDILKENDTITFLKLADTYQQIAEKGADAFYNGTIAE
NLVKDIRNAGGIITMEDLMNYTALLDENPLKVSVGEFTMFVPDAPSSGPILTLILNILNG
YNFTADSVSNTEKKILTYHRIVEAFKFAYAKRSVLGDPKFLNITDFIQNITSKSFADSIR
QKITDNTTHNDSYYEPEYFLPENYGTSHISVVDADGSAVSATSTINQYFGSKVMSSSTGV
LLNNEMDDFSSPLIINGFDLPPSPNNFIIPHKRPMSSMCPAILFDKNNKVKLVVGGSGGT
KITTSVAEVILKSLFFNYDLKKAVLDPRVHHQLSPKFTVLEPDFDTAVMDGLIKKNHLIE
MLTSTGAVVQAILHEENHLFAESDPRKGGYPAGY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggtacagaagtcagtggtggtgggtttggcggtgctgttaattgctgcagtggggaca
tttttaggtgtgttttttggatataggggtaacctttcacctgtcgtcattgagagatca
taccaacatgccgctgtagcggcagacgccgggccgtgctctgaagtcggcagagacatt
ctcctacagggtggttctgctgtagatgcagcaattgctggactgttgtgtgtaggtttg
atgaatgctcacagtatggggatcggaggaggcctgttcctcaacatctacaatgctgac
acaggaagagtggaaacaattgacgctcgtgaaacggcacccgctaactcctctcgggac
atgttcgggaacagcactgatctttctcagaaaggcggcctttccattgctgttcctgga
gaaattcgaggatatgagctggctcataagcgtcacggcaagctggcctggaaagaactg
ttcatgccaagcatcaaactcgcaaagaatggatttcctgtgggtaaagctctcgctgga
gcaattgccaacaacagaaacactatcctcacagatgaagaattatgttccgtattctgt
aacaaaaatggagatatcttaaaggaaaatgacacaatcaccttccttaaactggcagat
acttatcagcagattgcagagaaaggggcagatgcattttacaatggaacaatcgcagaa
aatcttgtcaaagacattaggaatgcaggtggcattataactatggaagatttaatgaat
tacactgcactgttggatgaaaaccctctgaaagtatcagtgggtgaatttacaatgttt
gtgccagacgctccatccagtggccccattctcaccctcatcctcaacatcctgaacggt
tataacttcacagcagacagcgtttccaacactgagaagaaaattctcacatatcatcgt
atagtggaggctttcaaatttgcatatgctaaacgcagtgttctgggagaccccaaattt
cttaacatcactgattttatccagaacatcacatctaaaagctttgcagattcaatccgg
cagaaaatcacggataacacaacacataatgacagttattacgaacccgaatattttctt
ccggaaaattatggaacatctcatatttctgtagtggacgcggacggaagtgcagtctct
gccaccagcaccattaatcagtattttggctccaaggttatgtcctcatctacaggagtg
ttgttgaataatgagatggatgatttcagttctcctctgataattaacggatttgatctt
ccaccttcacctaataacttcatcataccacataagcgtcccatgtcgtctatgtgtcct
gctatcctgtttgataaaaataacaaagttaaactggtggttggtggctcaggagggaca
aaaatcacaacatcagttgctgaggtcattttaaaatcactgttcttcaactacgatctg
aagaaagccgttcttgatcccagagttcatcatcagctcagtccaaaattcactgtgtta
gagccagattttgacacggctgtaatggatgggcttattaagaaaaatcacctgattgag
atgttgacatcaacgggtgctgtggttcaggcgatcctacatgaggaaaaccatctattt
gctgaatccgaccctcgaaagggaggataccctgcaggatactga

DBGET integrated database retrieval system