KEGG   Pangasianodon hypophthalmus (striped catfish): 113544317
Entry
113544317         CDS       T05759                                 

Definition
(RefSeq) adenylate cyclase type 4-like isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00230  Purine metabolism
phyp01100  Metabolic pathways
phyp04020  Calcium signaling pathway
phyp04114  Oocyte meiosis
phyp04261  Adrenergic signaling in cardiomyocytes
phyp04270  Vascular smooth muscle contraction
phyp04371  Apelin signaling pathway
phyp04540  Gap junction
phyp04912  GnRH signaling pathway
phyp04914  Progesterone-mediated oocyte maturation
phyp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113544317
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113544317
   04020 Calcium signaling pathway
    113544317
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113544317
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113544317
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113544317
   04914 Progesterone-mediated oocyte maturation
    113544317
   04916 Melanogenesis
    113544317
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113544317
   04270 Vascular smooth muscle contraction
    113544317
Enzymes [BR:phyp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113544317
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 113544317
NCBI-ProteinID: XP_026798862
Position
Unknown
AA seq 1198 aa
MQDDSHDCVEMNTKNPEDLSQQNGYINQIRKQTKHEEIQKDNNSAQDGNKQPNGNGIGQL
NIELGIAKKENTPEPLQVCTSFKTSNATPNGLPYSSLPEASVEDNTTNGVGNCLQSRRTD
HDCSEPEPEVTGVPERQSVRIRRNAATGASRCYQTMRLGFLQCLEDTPFVVPGLVLTILF
CVTIIVVIAATSRHITGHVGALAVVCVVLCLCVLLLVCLPCLPTLRRCEQMLALSIWFTL
FITAIVFIFTDKVTAWEQVAFFLFLSLSVYTILPLTFWWAMIFGIGASVCHIIIISVSVS
ASRPRQRDVAVQLVANAVLFVCINCVGLFHLWLIENARRKSTMSRETFSYNRSKRATQKR
DQEHLLLSVLPRYIAMELKGEVVKGLSRTFAGVDNKPNFHNLYVKQHKDVSILYADIVGF
TSLASTCTPEELVVVLNKLFGKFDDIAKKNECLRIKILGDCYYCVSGLPDPIPHHARNCV
QMGLDMCTAINKLREATGVDISMRVGVHSGNVLCGVIGLLKWQYDVWSNDVTLANRMESG
GVPGRVHITEETLGNLGGAYQVEEGNGASRDSALEGRKTYLVIDPNPQNSTDEKPKTNIL
MMNGRPKQRASVRMSQYLQSWKSINPFSELNRPEDSIAAPLSPSNNFSQSQGDTESVNHQ
PYTSYQESRLSSVSENGSMASLDPLDASGSKTKKLNWLTLFFSDINMEKQYQLSEVKDIH
QSAACLALIFTAIFTVQMLTSQKNTPLAISYGVTFPIQLLILLVISMGFLKQFNSKIPPS
MQWLSLLPYGVATKVLLRLLLVFTCLLITLLMAILNLVFIPGDNCLNSTNNATTLDNLNL
YSVPYYLYCCLLAMLGVVVFVRVCFSVKLFLLTLALVVYLALFLYVYAPRSDCYMQQLYN
VSNNPGVLKEPKIMSGVWLCIFYFTSLILARQDELACRVEFLLEKCFEKEREEMEMTENI
NKLLLENLLPCHVTNFFIGKNVPNQCVFQDLYSQSCEAVCVMFASVPEFKEFYTESSVNG
DGLECLRFLNEIITDFDELLSKPKFNVVEKIKTIGTTYMAAAGLTNPTTGEERKDSDACK
NNVRSMVDFAMALMGRLENINRHSFNNFKLRIGINHGPVIAGVIGAHKPQYDIWGNAVNV
ASRMDSTGVLNKIQVTEETAQVAESMGFVVTKRGIINVKGKGQLTTYFINTEPSSQYP
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgcaggatgactcacatgattgcgttgaaatgaacaccaaaaatcctgaggacttgtca
cagcaaaacgggtatataaaccaaatcagaaaacagactaagcatgaagaaatacagaaa
gacaataattctgcccaagatgggaataaacaacccaatggtaatggaatcggacagctc
aacattgagctaggaattgctaagaaagagaacaccccagaacctcttcaagtatgcaca
tcctttaagacatccaatgcaaccccaaacggcctcccatactcatcacttcctgaagcc
agtgtggaagacaacactaccaacggtgtagggaactgcttacaatcccgcagaactgat
cacgattgttcagaaccagagccagaggtcacgggagtccctgagcgtcagagtgtgaga
attcggcgcaatgctgccaccggagcaagtcgctgttaccagactatgcggctgggattt
ctgcagtgcctggaggacaccccgtttgtggtaccaggcctggtattgaccatcttgttt
tgtgtgaccatcatcgtcgtcattgctgctactagcagacatatcactggtcatgtagga
gcattagcagtggtgtgtgttgtgctctgtctttgtgtcctgctgttggtgtgtttgccg
tgcctgcccaccttgcgtaggtgtgaacagatgcttgcgctctccatctggttcacacta
ttcatcactgccattgtcttcatcttcaccgacaaagtcaccgcatgggaacaagtggcg
ttttttctctttctttctctatcagtatacacaatcttacctcttactttctggtgggct
atgatctttggtatcggagccagtgtgtgtcacatcatcattatcagcgtcagtgtgtct
gctagccgccctaggcaacgtgacgtggcagtgcagctggtagcaaatgcagtgctgttt
gtgtgtataaattgcgttggactttttcacctctggcttattgagaatgcaagaagaaag
tccaccatgagccgagaaacctttagctacaaccgctccaaacgagccacacagaagcgt
gatcaggaacacctcctcctgtccgtgctgccccgatacattgccatggagctcaaaggc
gaggttgtcaaaggtctgtcaagaacattcgcaggagtcgacaataagccaaacttccac
aatttatatgtcaagcagcacaaagacgtcagcattctgtatgcagacattgtaggtttc
accagtctggccagcacctgcactcccgaggaactggtcgtcgtccttaacaaactcttc
ggcaagtttgatgacattgccaagaaaaacgagtgtctgcgtatcaagatcctgggtgac
tgctactactgcgtttcaggccttccagatccaatccctcaccatgcacgcaactgtgta
cagatgggactagatatgtgcactgccataaataagctgagagaggcgacaggtgtcgac
atcagcatgagggttggcgtacactcaggaaacgtactttgtggggtaattggcttgctc
aagtggcagtatgatgtctggtcaaatgacgtaacgctagccaatcgcatggagtctgga
ggtgtccctggaagggttcacattacagaggagacccttggaaacttaggcggggcgtac
caagttgaggaggggaacggagccagtcgggattctgctttggagggcaggaagacatac
ctagtgattgaccccaacccacagaacagcactgatgaaaaaccaaagaccaacatcctg
atgatgaatggtagaccaaagcagcgggcttcagtgagaatgtctcagtatctacagtcc
tggaagagcatcaaccccttttcagagctcaatcgaccagaggactctatcgctgcccca
ctcagcccatcgaataacttcagtcagtcacagggggacactgaatcagtaaatcatcag
ccatatacttcctaccaagaaagcaggctttcatctgtgtcagaaaatgggtcaatggcg
tcattggacccactagatgcgtcaggatcaaaaaccaagaaactcaactggctgacactg
tttttcagtgatataaacatggaaaagcagtatcagctgagcgaggtaaaggatatccat
cagtctgcggcctgtctggctcttatcttcactgccatattcactgtacagatgcttacc
tcacaaaaaaatactcccctggcgatatcatatggagtcacctttcctatccagttgctg
atactgctggtgatcagcatgggattcctaaagcaatttaactctaagatcccacctagt
atgcaatggttgtcattactgccatatggagtagccaccaaagtgttgctgagactactc
ctggtcttcacctgtctcctcatcacactactcatggccatcctgaacctagtttttatt
ccaggtgataactgcctaaactccaccaacaatgccaccacactggataatctaaacctt
tattctgtaccgtattatctgtattgctgtttattggcaatgctgggggtggtggtgttt
gtacgagtgtgtttttctgttaaactcttcctcctcacacttgcactagttgtctacctt
gctctcttcctctacgtgtatgcgccacgttctgattgctacatgcagcaactctacaac
gtttccaacaatcctggagttctaaaggagcccaagatcatgtcaggggtttggctctgc
attttctacttcacctctctaattcttgcccgacaggacgagctggcctgtcgagtcgag
ttccttctagagaagtgttttgagaaagagcgtgaggagatggagatgacagaaaatatc
aacaagctcctcctcgaaaatctgctgccttgtcatgttaccaacttctttattggcaaa
aatgttcccaatcagtgtgttttccaggatttgtacagtcagtcttgtgaagctgtgtgc
gtgatgtttgcctcagtgcctgagtttaaggaattctacacagagagcagtgtaaatgga
gatggcctggagtgtctgagattcctcaatgaaatcatcacagactttgatgagctcctc
agcaagcccaagttcaatgtagttgagaaaattaagactattggcaccacatacatggct
gctgctggactgaccaatcccactacaggagaggagcgaaaggacagtgacgcgtgcaaa
aataatgtgcggagtatggtggacttcgccatggctttgatgggaagactggaaaacatc
aatagacactctttcaacaacttcaaactcaggataggaataaaccatggccctgtcatt
gctggagtaattggagctcataaacctcagtacgacatctggggcaacgctgtgaatgta
gccagcagaatggacagcactggtgtactaaataaaatacaggtgactgaagaaactgcg
caggtagctgagagcatgggctttgtcgtgaccaagagaggcatcattaacgtgaaaggc
aaaggacagcttactacttacttcatcaacactgagccatcatcacaatacccatag

DBGET integrated database retrieval system