KEGG   Pangasianodon hypophthalmus (striped catfish): 113544535Help
Entry
113544535         CDS       T05759                                 

Gene name
atg16l1
Definition
(RefSeq) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04136  Autophagy - other
phyp04140  Autophagy - animal
phyp04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113544535 (atg16l1)
   04136 Autophagy - other
    113544535 (atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    113544535 (atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phyp04131]
    113544535 (atg16l1)
   03029 Mitochondrial biogenesis [BR:phyp03029]
    113544535 (atg16l1)
Membrane trafficking [BR:phyp04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    113544535 (atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    113544535 (atg16l1)
Mitochondrial biogenesis [BR:phyp03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113544535 (atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 KASH_CCD DUF4472 HALZ DUF5082 Lectin_N APG6_N FAM76 Bacillus_HBL PhoU
Motif
Other DBs
NCBI-GeneID: 113544535
NCBI-ProteinID: XP_026799174
Position
Unknown
AA seq 399 aa AA seqDB search
MAMAGRRVECVWKRHVAEQLKQRDRVQRQAFEEIIQQYNRLLEKSDLQAVLSERLQTEKY
EPQNRHDLSPGAESSRCDMLQQEMSQMRIKHQEELTELHKKRGELAQNVIELNNQIQQKD
KEIQNNEAKMLEYQQQISQLEGDCRELRNCLSDLERANQTLRDEYDALQITFSALEEKLR
KTTEDNQELVTRWMAEKAQEANRLNAENEKDCSSVSRRRSLNSHGSPPDNAETPSGGCAD
VRVPSTALHVFEAHDGEVNAVRFSPGSRQLATGGMDRRVKLWEVMGGRCEYKGALMGSNA
GITSIEFDSTGSYLLAASNDFASRIWTVDDYRLRVSLSLCHTHTHTHTHTYYCLAVAVGY
QMILDKGHSSSVNAVSWSPSGSYVLSVEKSSKAVLWSDM
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggcaggtcgcagggtggagtgtgtgtggaagaggcacgtggcggagcagctg
aagcagagggaccgtgtgcagagacaagcttttgaggagatcatccagcagtataacagg
ttgttggagaagtcggacctgcaggccgtgctctcagagaggctgcaaacagagaaatat
gaaccacagaacagacacgatctcagcccgggggccgagtcgagccgctgtgacatgctg
cagcaggaaatgtctcagatgcgcatcaaacaccaagaggagctcacagagctgcacaaa
aaacgcggagagctggcccagaatgtaatcgagctgaataaccagattcaacagaaagac
aaagagattcagaacaacgaggccaagatgttggagtaccagcagcagatctcccagctg
gagggcgattgccgcgagctgcgcaactgcctgtcggacctggagcgagccaatcagacg
ctgcgggacgagtacgatgcgttacagatcacgttcagcgctctggaggagaaactgcgc
aaaaccacggaggacaatcaggagctcgtgacacgctggatggccgagaaggcgcaagag
gctaaccggctcaacgcggagaacgagaaggactgcagtagtgttagcaggcggcggtct
ctgaactcccacggctcgcccccggacaacgcggagaccccctccggaggatgcgccgac
gtccgcgtcccctccactgcactccacgtgtttgaagcccatgacggtgaggtgaatgcc
gtcaggttcagtcccggttctcgtcagctcgctacaggaggaatggaccgacgtgtaaaa
ctgtgggaggtgatgggaggtcgctgtgagtataaaggtgctttaatgggcagtaacgct
ggaatcaccagcatcgagttcgacagcacgggatcttacctgttggctgcgtccaacgac
ttcgcgagccgaatctggactgtagacgactacagactgagggtgagtctctctctctgt
cacacacacacacacacacacacacacacttattattgcttagctgtagctgtaggttat
cagatgatactcgacaaaggacacagctcctctgttaacgcagtgtcgtggtctccatct
ggttcctacgtgctcagtgtggagaagagcagcaaagccgtgctctggtctgacatgtga

DBGET integrated database retrieval system