KEGG   Pangasianodon hypophthalmus (striped catfish): 113544589
Entry
113544589         CDS       T05759                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein
  KO
K04462  ecotropic virus integration site 1 protein
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113544589 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113544589 (mecom)
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    113544589 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_6 zf-BED PyrI_C zf-C2H2_11 zf-C2H2_8
Other DBs
NCBI-GeneID: 113544589
NCBI-ProteinID: XP_026799277
Position
Unknown
AA seq 959 aa
MSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHI
HSSVKPFMCKSLTPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLN
KHRRFCEGKNHFAAAAGGLFGPGMALPGTPGMDKSALGLGPGSGGLADYFGPNRHHGGLT
FPAAPAAFPFSFPGLFPSGLYHRPPLIPATTPIKSPPALDFQKSPPLSSPVPGMQESQDL
LMSLRKHSINGEGTENGPEHLIEGSATKARQGIKTSDHSESSDLDDVSTPSGSELESTSG
SELDSDAESDRDQERDRENGKGPKRRSSSPTMGQSPARGSSNNGSAGNINGTDVPPQGLF
SPTADEHTAVSGAVNDSIKAIASIAEKYFGSTGLAGLHNKKGDPLGYPAMFPLPFFPAFS
PPVYPFHEREHLRPRGIKGEPESPLQESKKPQGSTAESPFDLTTKRKEECLAQTFATSKL
EVPHILSANQDQPLDLSLGGRSRSTRLKSGESRKNHIIGEDRIETEPPKADSTIQHARPT
PFFMDPIYRVEKRKATDPFEALKEKYMRPTPGFLFHPQLRMPDQRTWMSAIENMAEKLEA
FGPLKSDATDIMRSVPSMFDFRAPATTLPETLLRKGKERYTCRYCGKIFPRSANLTRHLR
THTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHE
NGNLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISSSGQSAGSPPHSDEGLNSGHF
EDDKAVTDPRSHDLDEEEGEEPGVEEEEAELCDANKPANKVASSNLGDDIANDINDDIND
ELDYDGAPDGLLDCKSSPQRFDEDDEDEEHGGFPALDHIRHFTAEEAELSDSDVTGFDSA
HLPEAVKQPLYRKSKSQAYAMMLSLADKDPLPPSSHAASVWHTLGRAAESNAIQSLSHV
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgtcacatgacagcggcaagcactatgaatgtgaaaactgctccaagcaggtgtttaca
gacccaagtaacttgcagaggcacatccgctcgcagcacgttggtgcacgggcacacgcc
tgccccgactgcggcaaaaccttcgccacgtcgtccggcctcaagcagcacaaacacatc
cactcgtccgtcaagcccttcatgtgtaagtctctcacccccttcatatgcgaggtatgc
cacaagtcctacacccagttctcaaacctgtgcaggcacaagcgcatgcatgctgactgt
cggactcagatcaagtgcaaagactgtggccagatgtttagcaccacttcttccctcaac
aaacaccgccgcttctgcgaaggcaaaaaccattttgctgctgccgcaggagggctcttt
ggccctggcatggctcttcctggcactcctggaatggacaagtccgctctaggactgggg
ccaggctccggtggtttggcagattattttggtccaaatcggcaccatggcggactaacg
tttccagcagctcctgcagcattccccttcagttttccaggactcttcccatctggactg
taccatcggccacccctcatccctgccacaactcccataaaaagcccaccagccttggat
ttccagaagagtccaccattatcctcgcctgtgcctgggatgcaagagtcccaggacctc
ctgatgagcctccgaaagcactcgatcaatggggaaggaacagaaaatgggccagagcac
ctaatagagggctccgccaccaaggcgagacaaggcatcaagacaagtgaccattcagag
agtagtgacctggatgatgttagcacaccaagtggaagtgagctagagagtacttccggg
tcagaactggacagcgatgctgagagtgaccgggatcaagaaagggatcgggaaaatggg
aaaggaccaaagaggagatccagtagtcctaccatggggcaaagccccgcccgtggcagc
tctaacaatggcagtgctggcaacataaacggaaccgatgtgccaccgcaaggacttttt
tctcccactgcggatgagcataccgctgtttctggagccgtcaatgattccatcaaggcc
attgcatctattgcggagaaatactttggctccacaggacttgcagggctgcacaataaa
aaaggggacccattgggataccctgccatgtttcctctccccttctttcctgccttctct
cccccagtctaccccttccatgagagggagcatcttcgacctcgaggcatcaaaggagag
ccagagagtccattgcaagaaagcaagaagccacaaggcagtactgctgaatctcccttc
gacctcactaccaagcgcaaagaggagtgcctagcgcagacctttgccacctcaaagctg
gaggtgcctcatatactctcggccaaccaggaccaaccactggacctgagtttgggtggg
cggagccggagcacacgcctaaaatcaggggagtcacggaagaaccacataattggagag
gacagaattgagacagagcctccaaaagcagactccactatccagcacgcaagacccacc
ccattctttatggacccaatctacagggttgagaagagaaaagcgacggatccgtttgag
gcgctgaaagaaaagtatatgcgtcccacaccaggcttcctcttccacccacagctccgc
atgcctgatcagaggacctggatgtcagcgatagaaaacatggcggagaagttggaagcg
ttcggcccgttgaagtcagacgccactgacatcatgcgctcggttccctccatgtttgat
ttccgagctccagctacgacgctgcccgaaacactgctgcgtaaggggaaggaacgctac
acctgcagatactgcggcaaaatattcccacgctcagctaacctcacacggcatctcaga
acacacacaggggagcagccgtacaggtgtaagtattgcgatcgttcgttcagtatctcg
tcaaatctgcagcgccacatcaggaacatccacaacaaagagaaaccgttcaaatgccac
ttgtgtgaccgctgctttggccaacagaccaacctggaccggcacctcaaaaaacacgag
aacggtaatctgtcaggcacggcaatgtcgtcgccgcagtcggagctggacagcagcagc
gccattctggatgataaagaggactcgtacttcaacgaaattcgcaacttcatcagcagc
agcggccagagcgctggctcacctccacactccgatgaaggtttaaacagcggccatttc
gaggatgacaaagccgtcactgatccaaggtcacatgacctggatgaggaggaaggggag
gagccaggagtggaggaagaggaagcagagctttgtgacgccaacaaacctgccaacaaa
gtggcgtctagcaacctaggcgacgacatcgccaatgacatcaacgatgacatcaatgac
gagctggactacgacggcgcacccgatggactgctggactgcaaatcttcaccacagagg
tttgacgaggatgacgaggacgaagagcacggtggattccctgcgctggatcacatccgc
cacttcaccgcagaagaggcggagctcagtgacagtgatgtcacaggatttgactccgcc
cacctgcccgaggctgtgaagcagccactgtacaggaagtccaagtcacaggcttatgcc
atgatgttatctctggcagataaagaccccctgcccccttcctctcacgctgcctcggtg
tggcacacactcggacgcgcagccgagtccaacgccatccagtccctcagtcacgtatga

DBGET integrated database retrieval system