KEGG   Pangasianodon hypophthalmus (striped catfish): 113544911Help
Entry
113544911         CDS       T05759                                 

Gene name
acads
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00071  Fatty acid degradation
phyp00280  Valine, leucine and isoleucine degradation
phyp00410  beta-Alanine metabolism
phyp00640  Propanoate metabolism
phyp00650  Butanoate metabolism
phyp01100  Metabolic pathways
phyp01200  Carbon metabolism
phyp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    113544911 (acads)
   00650 Butanoate metabolism
    113544911 (acads)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113544911 (acads)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113544911 (acads)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113544911 (acads)
Enzymes [BR:phyp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     113544911 (acads)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N DUF743
Motif
Other DBs
NCBI-GeneID: 113544911
NCBI-ProteinID: XP_026799779
Position
Unknown
AA seq 405 aa AA seqDB search
MAALFKARKALSSVVRCTRCFTQLAELPELHQILRQTCQDYAAKELAPIAAQLDKNHSFP
AKQIRELGAMGVMAMEVPENLGGAGMDYLAYSLAVEEISRGCASTGVIVSVNNSLYLGPI
LKFGTEEQKQQWISPFTTGEKVGCFALSEPGNGSDAGAASTLAHQKGDEWVLNGTKAWIT
NCCDASAAVVFATTDKSLKHKGISAFLVPMPHPGLSLGKKEDKLGIRASSTANLILEDCR
IPLGNLLGQRGMGFKIAMQTLDSGRIGIASQALGIAQAAIDCAADYAQKRIAFGAPIAKL
QAIQFKLADMSVAIESARLLTWKAALLRDAKKPYSKEAAMAKLAASEAATFVSHQAIQVL
GGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIANQVLKEYQQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcagcactttttaaagcccggaaagccctgagcagtgttgtgagatgtactcgttgc
ttcactcagcttgcagaattacctgaactccatcaaattctgaggcagacatgccaggac
tatgcagcaaaagaacttgctccgattgctgcacagcttgacaaaaatcattcttttcca
gctaaacagattcgggaacttggagcaatgggtgtgatggccatggaggtaccagagaat
cttgggggagctggaatggattatttggcgtatagtctggctgttgaagagataagcaga
ggctgtgcatccactggggtcatcgtcagtgtcaataattcattatatctgggccctatt
ctgaagtttggcacagaagagcaaaagcagcagtggatatctccctttaccactggggaa
aaagtaggctgcttcgctttgagtgagccaggcaatgggagtgatgcaggtgccgcctcc
acgctggcacatcagaagggagatgaatgggtgctgaatggcaccaaggcctggatcacc
aactgctgtgatgcatctgctgcagttgtcttcgccacaacagataagagcttaaaacac
aagggaatcagtgccttcctggtacctatgcctcatccgggcctatctcttggaaagaaa
gaggataagcttgggatccgagcatcatccacagcaaacctgattctggaggactgtcgt
atcccactgggaaacttactgggccagcgtgggatgggcttcaagattgccatgcaaacc
ctggacagtgggcgcattggtatagcatctcaggctcttgggattgcacaagcggctatt
gactgtgcagctgattatgctcagaagaggatagcctttggagcaccaattgcaaagttg
caagcaatacagtttaagctggcagacatgtctgtggctatagaaagtgctcgtcttctc
acctggaaagctgcactgttacgagatgcaaagaaaccctattccaaggaagctgctatg
gccaagctggctgcatctgaagcagcaacatttgtttctcatcaggccattcaggtgttg
gggggaatgggttatgtaacagacatgcctgctgagagacactaccgcgatgcccgcatc
actgaaatctacgagggaaccagcgaaattcagagacttgtcattgcaaaccaggttttg
aaggaatatcagcaatag

DBGET integrated database retrieval system