KEGG   Pangasianodon hypophthalmus (striped catfish): 113544977Help
Entry
113544977         CDS       T05759                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Pathway
phyp00564  Glycerophospholipid metabolism
phyp00565  Ether lipid metabolism
phyp00590  Arachidonic acid metabolism
phyp00591  Linoleic acid metabolism
phyp00592  alpha-Linolenic acid metabolism
phyp01100  Metabolic pathways
phyp04010  MAPK signaling pathway
phyp04217  Necroptosis
phyp04270  Vascular smooth muscle contraction
phyp04370  VEGF signaling pathway
phyp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113544977
   00565 Ether lipid metabolism
    113544977
   00590 Arachidonic acid metabolism
    113544977
   00591 Linoleic acid metabolism
    113544977
   00592 alpha-Linolenic acid metabolism
    113544977
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113544977
   04370 VEGF signaling pathway
    113544977
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113544977
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113544977
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113544977
Enzymes [BR:phyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     113544977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 113544977
NCBI-ProteinID: XP_026799867
Position
Unknown
AA seq 790 aa AA seqDB search
MKKELAPHWNLSVTVLRGKFQRSHDYFSQPDLYVTLHLPTASACTLRTRTINNSKTPEWN
ETFHFRAYSQAKNILELNLYDADVVEDDKCTAILFDISTLKLGQKETKVFITDDTMKDML
WVEFEMTESPEVPGQYLSNGVLLAAPLSTLEVKLPTDVRHDMLLKLLGAYKEDQVISMSK
NNSLMQTLRYYINKNLETKMELWMKDNESPTVVPVTPFGPKHELTLTLPVAEENINLHLN
TVDSSEEDMTVRLDFDIPAEEKAFLVKRREVVSRALQTFLNLETPLDSTQVPTVALVCSG
GSSRAMTGMHGSLKGLQSLGLLDAISYITSVSGSTWATAGLYSDPFWSKEGLDKAIASVQ
KELSKSTTSLFSPTQLLYYQSELRNREKEGHSVSFIDTWGLIIEHLIFGKKHTGTLSDQR
KAVSEGQNPLPIYTAVNMKKDASGCLVPEWCEFTPYEVGFSKYGAFVPAETFGSEYYLGH
VVKKLPETRISFLLGMWSSVFSANLMQLWSAFTGVIPSWAFRLGDKVDKIETDSKPLTLD
TLRVRPEASVLSSFVNDCPIISSVFNFLRGFSLHNLYGESPGFNTSNETHPDAFPNKLTP
ADSTLSLVDSGFAINTAFSPVLRPHRRADVIMCLDNSWVEDHLKTLKDTQQYCSDHKLPF
PKIDFDKYKSEPKREVYVFEDETNPDAPIVIHIPLANISFKEYKAPGVRRSGKKELKDGN
IDVSSRSSPYITKNITFKSEDFQRLVDLTFYNIVNNREIIRNAVKKALNKKGLVNMPSGG
GESTYYCTLT
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaactggcgccgcactggaacctctctgtcacagtgctacgaggaaagttc
cagcgttcacatgattacttttcacagcctgacctctacgtgaccctgcacctgcccaca
gcctcagcttgtactctgagaaccaggacaatcaataactccaagacacccgagtggaac
gaaaccttccacttccgtgcctacagccaggcgaagaatatcctggagctaaatttgtat
gacgcagacgtagtggaggatgacaaatgcaccgccattttgttcgacatcagcaccctc
aaactgggtcagaaggagaccaaggtcttcatcacggatgacacgatgaaggacatgctg
tgggtggaatttgagatgacagagagtcctgaagtgcctggtcagtacctctctaatgga
gtcttattggccgccccgttgtctactctggaggtgaaactgcccacagacgttcgacat
gacatgctgttaaagttactaggagcgtataaggaagatcaagtgatctcaatgagcaag
aacaacagcctcatgcagactcttcgctactacatcaacaaaaacctggagaccaagatg
gaactctggatgaaggataatgaaagcccaacagtagttcctgtaactccatttggacca
aaacatgaattaacactcacacttcctgtggcagaggaaaacataaatttacatttgaac
acagtggacagctctgaggaggacatgacggtgaggctggattttgacataccggcagag
gagaaggcgtttctggtgaagaggagagaggtggtgtctcgtgcactgcaaacgttttta
aacctcgaaactccattggattccacccaggtgccgacggtggctctggtgtgttcagga
ggcagctccagggccatgacgggcatgcatggctctctgaaaggactgcagagccttggc
ctgctcgatgccatcagctacatcacctctgtttctggctccacctgggccactgctggt
ctctattctgacccattttggtcaaaggaaggcctggataaagcgatagcatctgtgcag
aaggagctatctaagagtacgaccagtctcttctctcctacacagctgctttattatcaa
tctgagctgcggaacagagagaaagaaggccactccgtctccttcatcgatacctggggg
ctcatcatagaacacctcatctttggaaagaaacacacaggtacactgtctgaccagagg
aaggcagtctctgagggccagaacccgctcccaatctacacagcagtgaacatgaagaag
gatgccagtggctgcttagtgcctgagtggtgtgagtttaccccatatgaggtgggattc
tccaaatatggagcatttgtccctgcagaaacttttgggagtgagtactacctgggtcat
gtggttaagaagctaccggaaacacgcatctccttcctcctgggtatgtggagcagtgtt
ttctctgctaacctgatgcagctctggagtgcttttactggagtgataccatcctgggct
ttccggctgggagataaggtcgacaagatcgagacagatagcaagcccttgaccttggat
actttgcgagtccgtccagaggcttcagtgctgagcagcttcgtgaatgattgccccatc
atcagcagtgtgtttaacttcctgagaggattctctctgcacaacttgtacggcgaaagc
ccaggattcaacacctctaatgagacacaccctgatgcgtttccaaacaagttgacccca
gcggactccactctaagcttggtggattctggatttgccattaacacagctttctctcct
gtgctacggccccacagacgtgccgacgtcattatgtgcctcgacaatagttgggttgaa
gatcatttaaagaccctgaaggacactcagcaatactgtagtgaccacaagttgccattt
ccaaagatagacttcgacaagtacaaatctgagccaaaaagggaagtgtatgtgttcgaa
gatgagacgaatcctgatgctcctatcgtgattcacattccactggccaacatctccttc
aaagagtataaagcaccaggagtaaggagaagcggaaagaaggagctaaaggatggaaat
attgatgtgagctccagatcctctccatacattaccaagaatatcacatttaagtccgaa
gacttccaaagactggtggacctcaccttctacaacattgtgaacaaccgagaaatcatc
agaaatgcagtgaagaaagctctgaacaaaaaagggcttgttaacatgccctcaggtgga
ggtgaaagtacatattactgcacactcacttaa

DBGET integrated database retrieval system