KEGG   Pangasianodon hypophthalmus (striped catfish): 113546332
Entry
113546332         CDS       T05759                                 

Definition
(RefSeq) uncharacterized protein LOC113546332
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
phyp  Pangasianodon hypophthalmus (striped catfish)
Brite
KEGG Orthology (KO) [BR:phyp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phyp03000]
    113546332
Transcription factors [BR:phyp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    113546332
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 113546332
NCBI-ProteinID: XP_026801919
Position
Unknown
AA seq 602 aa
MIPPGDCLYAGRKRRKPIQKQKPAGVNQKSNPSKRHRDRLNAELDRLASLLPFTPEVISK
LDKLSVLRLSVSYLRVKSFFQTIQEKSNKKQSPASCSPEPKKHSLGNSILESDLLLESLT
GFALIVSSDGVIFYASSTIVDYLGFHQTDVMHQNVFDYIHVDERQEFRRQLHWAMNPQQE
HHSPSGTDEDYMVRSLFNAQETDGVPPELSPFLTRCFIARVRCLLDNKSGFLRMQFQGSL
KFLQGQKRKSKSGALLPPQLALFCVAVPLVLPSITELKIKGMISKQKVSNISEKRLHISR
TSCDAGDMTLNWHSGSWATLTKEGIQYKSEGLCSQDEPLNFCVSSVAVHKVQPTQSPWDS
RCHSASHSGYFSSKLGKHVQSGKFRFSPGCTAAISQCKQYGLSDKDGYCGYRKTESRYMA
NNDCYSNLLLPETAIKTEHDSDSENGCSVYGAPHNGVWRYSTPFPDANQVKTEEDYDEYY
CKPSITNVSSINGHHKYLYTGAGRPLKCVLNKDHSDPHSLQGTNCHTYMNSSESKVFMQP
DYKLSYEVRNHSLLHPIKREPMDSLPWTDGSHDVIQEHMDRNEANCALNTVVHKTSAYLY
MQ
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgattccacctggagactgtctgtatgctgggaggaagaggagaaagcccattcaaaag
caaaaaccagcaggagtgaaccagaagtcgaacccgtctaagagacaccgggaccgactc
aatgccgagttggaccgactggccagcctgttgcccttcactccagaggtcatctccaaa
ctggacaagctgtcggttctgcgtctcagtgtgagctatctccgcgtcaagagcttcttt
caaactattcaggagaaatcaaacaaaaagcaaagccctgcatcctgcagccctgagccc
aaaaaacacagtctcggcaacagcattctggaaagtgatcttcttcttgagtctttgaca
gggtttgcgctgattgttagctcagatggagtcatcttctatgcttcctctacaatcgta
gactacctgggcttccatcagaccgatgtaatgcaccagaacgtctttgattatatccat
gtggacgagcggcaggagttcagaagacagctgcattgggccatgaatccccagcaggaa
caccactctccctcaggaactgatgaagactacatggtgagaagtctgtttaacgctcaa
gagacagacggtgtccctcctgagctttctccattcctcactcgctgcttcatcgctcga
gtacgctgcctgcttgacaacaagtccggctttctgaggatgcagttccagggcagtctg
aagttcctccaaggccagaagaggaagagtaaatccggagctttgctgccgcctcagctg
gctctgttctgtgtggccgtgccgcttgtcctgccctccatcaccgagctcaagataaag
ggcatgataagcaaacagaaagtctccaacatcagtgaaaagaggctccacatttctcgc
acttcttgtgatgctggcgacatgacgcttaactggcacagtggatcgtgggcgactctt
accaaagaaggcatccagtataaaagtgaaggtctctgcagccaggacgagccccttaac
ttctgcgtgtcctctgtggcggtccataaagtgcagcctacgcaaagtccctgggactct
cggtgtcactctgcctcacacagcggctacttcagcagcaaactggggaagcacgtccag
tccggaaaattccgcttctccccaggttgcactgctgcgatctcccagtgtaagcagtat
ggactcagcgataaggacgggtactgtgggtacaggaagactgagagtagatacatggcc
aataacgattgttacagcaacctactgctgcccgagactgccataaagacggagcacgac
tctgactcggagaacggatgcagcgtatatggcgcgccccataacggcgtctggcgctac
agcacgcccttccctgatgcaaaccaggtgaaaacagaggaagactatgatgagtattat
tgcaagcctagcatcacaaacgtctctagcatcaacggacaccacaaatatctctacaca
ggagcgggcaggccgctaaaatgtgtccttaataaagaccattctgatccccacagcctc
cagggtacaaactgtcacacatacatgaacagctctgagtccaaggtctttatgcaaccc
gactacaagctgagctacgaggtgaggaaccacagtcttcttcaccccatcaaaagagaa
cccatggactctctgccctggactgacggtagccatgatgttattcaagaacacatggac
agaaatgaggcaaattgtgcactgaacacagtggtgcacaaaaccagtgcctatttgtat
atgcaataa

DBGET integrated database retrieval system