KEGG   Porphyrobacter sp. HT-58-2: CHX26_00475Help
Entry
CHX26_00475       CDS       T05364                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
phz  Porphyrobacter sp. HT-58-2
Brite
KEGG Orthology (KO) [BR:phz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHX26_00475
Enzymes [BR:phz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     CHX26_00475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AUX68188
UniProt: A0A2L0GG43
Position
complement(89395..91557)
Genome map
AA seq 720 aa AA seqDB search
MNLVRWACGAALLLSAGTLANCSQIFEGESEGGITNAMLVGADSDTANWIGHGRTYSEQR
FSPLDGINRENVGNLGLAWAADINGSRGQEATPLVIDGKLYLTTEWSIVKAFDAVTGKEL
WTHDPKVPKETGVKACCDVVNRGLAAWGDRLFFGTLDGRLVALDRETGRVEWETVTVDQT
KSYTITGAPRVIDGKVIIGNGGAEFGVRGFVAAYDADSGKQLWKFYTVPEGGQGDDAPAY
LQKAAETWNMDVLGASDAIGGGGTVWDSMAYDPDLDLLYIGVGNGSPWNRAYRSPGKDGT
GEGDNLYLSSIVAIRPKTGEYVWHYQTTPGETWDYTATQHIILADMEIDGRSRKVLMQAP
KNGFFYVIDRETGKFISAKPYVTVNWASGIDPVTGRPIENPAMRIDKTGKPAMVTPGALG
GHNWHPMAYHPGENLVYIPAFEAGMLYAPQANWKPDRARGFNVGFDFAGELPSDGGFRQQ
AAGALRGMLVAWDPVAQKPRWTVEHPGPWNGGVLATGGGLVFQGTVGSEFNAYDAATGKK
LWSFDAQTGIVAPPVTYTVDGEQYVAVLAGWGGAYALSVDGDLIKRKAPVRSIPRLLVFK
LGGTAKLGPRPDFADEPLDPPPSTATPQQIALGQAKYGRYCAVCHGPGAVGSTVLPDLRR
RASLASADAWRSIVSEGTGNGMAGFATSLSKDEIEAIRAYVIDRANADKAIESPRTASRR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgtgcggtgggcatgcggtgcggcgttgcttttgtcggccgggacgctggcg
aattgcagccagatcttcgagggcgagagcgagggcggaatcaccaacgcgatgctggtg
ggggcggacagcgataccgccaactggatcggccacggccgtacctattccgaacagcgc
ttctcgccgctcgatgggatcaaccgtgagaacgtgggcaatctgggcctggcctgggct
gcggacatcaacggcagccgcggccaggaggcaacgccgctggtgatcgacggcaagctc
tatctcaccaccgaatggagcatcgtgaaggcctttgatgcggtcaccggcaaggagctg
tggacccatgatcccaaggttcccaaggagaccggtgtcaaggcgtgctgcgatgtggtg
aaccgcgggctggcggcatggggtgaccggctgttcttcggcacgctggacggacggctg
gtggcgctcgaccgcgagacgggccgggtcgaatgggagacggtgacggtcgaccagacc
aagagctacaccataaccggcgcgccgcgcgtgatcgacggcaaggtgatcatcggcaac
ggcggggcggaattcggcgtgcgcggctttgtcgctgcctatgacgcggacagcggcaag
cagctgtggaagttctacaccgtgccggaaggcgggcagggcgacgatgcgcccgcctat
ctccagaaggcagccgaaacatggaacatggacgtgctgggcgcatcggacgcgatcggc
ggcggcgggacggtctgggattcaatggcctacgacccggatctcgatctgctctacatc
ggggtcggcaatggctccccgtggaaccgcgcctatcgcagccccggcaaggacgggacg
ggggaaggggacaacctttacctctccagcatcgtcgcgatccggcccaagaccggggaa
tatgtctggcactaccagaccaccccgggcgaaacgtgggactataccgcgacccagcac
atcatccttgccgacatggaaatcgacggtcgctcacgcaaggtgctgatgcaggcgccc
aagaacggctttttctatgtgatcgaccgcgagacggggaagttcatcagcgccaagccc
tatgtgacggtcaactgggcgagcggcatcgaccctgtcaccgggcgtccgatcgagaat
cctgccatgcgcatcgacaagaccggcaagcccgcaatggtcacgccgggcgcgctgggc
gggcataactggcacccgatggcctatcaccccggtgaaaatctggtctatatcccggct
ttcgaggcggggatgctctacgctccgcaagccaactggaagcccgaccgtgcgcgcggg
tttaatgtcgggttcgactttgccggcgaactcccctccgatggcgggttccgtcagcaa
gccgctggcgctttgcgcgggatgctggtggcatgggacccggtggcccagaagccgcgc
tggacggttgaacatcccggcccatggaatggcggtgtgctggcgaccggcgggggcctc
gtgttccagggcaccgtcggcagcgagttcaacgcctatgatgcggcgaccggcaagaag
ctgtggagcttcgatgcgcagaccggcatcgtcgccccgcctgtgacctacacggtcgat
ggcgagcaatatgtcgcggtgctggcgggctggggcggcgcctatgcgctgtcggtcgat
ggcgatctgatcaagcgcaaggcaccggtgcgcagcattccgcgcctgctggtgttcaag
ctcggcgggacagcaaagctcgggccgcgacccgatttcgccgatgaaccgctcgatccg
ccgcccagcaccgccaccccgcagcagatcgcgctggggcaggccaagtatggccgttac
tgcgcggtctgccatgggccgggtgcagtgggttcgaccgtgctgcctgacctgcgccgt
cgcgcttcgttggccagcgcggatgcctggcgcagcatcgtcagcgaaggcaccggcaac
ggcatggcaggctttgccacctcgctcagcaaggacgagatcgaagcgatccgcgcctat
gtcatcgaccgggccaatgccgacaaggcgatcgaatccccgcggacggcatcaaggcga
tag

DBGET integrated database retrieval system